KEGG   Aspergillus fumigatus: AFUA_5G10540Help
Entry
AFUA_5G10540      CDS       T01017                                 

Definition
glycogen branching enzyme GbeA
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
afm  Aspergillus fumigatus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AFUA_5G10540
Enzymes [BR:afm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     AFUA_5G10540
Exosome [BR:afm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AFUA_5G10540
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 747 aa AA seqDB search
MASTEASNIAQSAPPDGTGVIQLDPWLEPFRDALRHRFGLVENWIKTINENEGGLDKFSK
GYEKFGFNVNANGDITYREWAPNAVRAYLVGDFNNWDVAAHPMAKDNFGVWEITVPSKDG
MPAIPHDSKVKIAMDIPSGERIYRIPAWIKRVVQDLEVSPIYESVFWNPPESEQYKFKHS
RPRKPESLRIYEAHVGISSPETRVATYKEFTKNMLPRIKYLGYNAIQLMAIMEHAYYASF
GYQVNNFFAASSRYGTPDELKELIDTAHSMGLTVLLDVVHSHASKNVDDGLNMFDGTDHL
YFHEGGKGRHDLWDSRLFNYGHHEVLRFLLSNLRFWMEEYGFDGFRFDGVTSMLYVHHGI
GTGFSGGYHEYFGPSVDDEGVMYLTLANEMLHTLYPNCITVAEDVSGMPALCLPHSLGGI
GFDYRLAMAIPDMYIKLLKEKSDNEWEMGNLAFTLTNRRHGEKTIAYAESHDQALVGDKT
LMMWLCDKEMYTHMSVLTEFTPTIERGMALHKMIRLVTHGLGGEGYLNFEGNEFGHPEWL
DFPRAGNNNSFWYARRQLNLTEDHLLRYKFLNEFDRSMQLTEEKYGWLHSPQAYVSLKHE
IDKVLAFERAGLLWIFNFHPTESFTDYRVGVEQAGTYRIVLDTDDPEFGGFGRNLKETRF
FTTDMPWNGRSNYLQVYLPTRTALVCTPSTFPFVGDLRANKKLQCRSSPWKKHCSHLNGF
MPRLGRGQCESLHIDIKYVALPNNLPQ
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaactgaagcttcaaacatcgctcagtccgcgcctccagatggcacaggtgtt
atccaattggatccttggcttgaacctttccgcgacgctctacgacacagattcgggttg
gtcgaaaactggatcaagacaatcaacgaaaacgagggtggtctagataagtttagcaag
ggctacgagaagtttggattcaacgtcaatgccaatggagacatcacatatcgggagtgg
gctcccaatgctgtgcgagcttacttggtcggtgatttcaacaattgggatgtagcagca
caccccatggcaaaagacaactttggcgtatgggaaatcacagtgccgtcgaaggatggc
atgccagccattccgcatgatagcaaggtcaagattgcgatggacattcccagtggagag
cgaatctaccgtatacctgcgtggatcaagcgtgtggtccaggacctcgaagtgtccccc
atttatgagtccgtgttctggaatcctcccgagtctgaacagtacaaattcaaacattcc
cgcccgaggaaaccagagagcctccgcatctatgaggcccatgtgggtatctcatccccc
gagacccgggttgcgacatacaaagagtttacgaagaacatgctgcctcggataaagtac
ttggggtacaatgcgatccagctcatggccataatggaacatgcctactacgccagtttc
ggataccaggtcaacaacttcttcgcagcgagcagtcgttacggcacccctgacgagctg
aaggagcttattgatacagcacatagtatgggcttgacagtgcttcttgacgttgtccac
agccatgcgtcaaaaaatgtcgatgatggactgaacatgtttgatggaacagaccacctt
tatttccatgaaggaggaaagggccgacatgacctgtgggacagtcggttgttcaactac
ggccaccacgaggtcctgcgcttccttctgagcaaccttcgtttctggatggaagaatac
ggcttcgatggcttccgtttcgacggagtcacaagtatgctttatgtacaccatggtata
ggaaccgggttttcgggcgggtaccacgaatactttggcccttctgttgacgacgagggt
gtgatgtacctcactctcgccaatgagatgctccatactttgtatcccaactgcatcacc
gtggcagaagacgtctccggaatgccggctctctgtttacctcactccctcggcggcatt
gggttcgattaccgccttgcaatggccatcccagacatgtacatcaaactcctgaaggaa
aaatccgacaatgagtgggaaatgggtaatctcgccttcaccctaaccaacagacgtcac
ggcgagaagacaatcgcctatgcagaaagccatgatcaagccctggtcggcgataaaacg
ctcatgatgtggctctgcgacaaggaaatgtacacccacatgtccgtactgaccgagttc
acccccaccatcgaacgaggcatggccctgcacaagatgatccgactggtcacccacggt
ctgggaggagagggctacctcaacttcgaaggtaacgagttcggtcacccagaatggctc
gactttccccgagccggaaacaacaattccttctggtatgcccgccgccaactcaacctc
accgaagaccatctcctccgctacaagttcctcaacgagttcgaccgcagcatgcagttg
accgaggagaagtacggctggctgcactctccacaagcctacgtgagcctcaagcacgag
atcgacaaggtcctcgccttcgagcgcgcaggtctgctctggatcttcaacttccaccct
acagaaagcttcaccgactaccgtgtcggcgtcgagcaagcaggtacctaccgcatcgtc
ctagacactgatgatccagaatttggcggcttcggtcgtaatctcaaggagacccgcttc
ttcaccaccgatatgccctggaacgggcggagtaattacctgcaggtctatcttcctacc
cgaacagcgctggtatgtactccatccaccttccccttcgttggcgatttaagagctaac
aagaagcttcaatgcaggtcttcgccctggaagaaacactgtagtcatcttaatggattc
atgccacgtttgggtcgcggtcaatgcgagtcattacatattgatatcaaatatgttgcg
ctacctaataatttacctcaataa

DBGET integrated database retrieval system