KEGG   Aspergillus fumigatus: AFUA_5G12110Help
Entry
AFUA_5G12110      CDS       T01017                                 

Definition
hypothetical protein
Orthology
K11427  
histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
afm  Aspergillus fumigatus
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    AFUA_5G12110
Enzymes [BR:afm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     AFUA_5G12110
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 502 aa AA seqDB search
MGFFDHLQKGGAFSLQAQKPQIRKVVQTRPPPPSRSSSHTPVRSLSQTSPPGRVKRPRDS
TSRSVSRDPDHRPSKRLSTPLRNRKRPTPEQRFSSDDDASDTDTSFELRKRARTEDSAEP
DLARRIRSLKAFSEENVKPLPLVHAADITSKQKAGNFRRAFGGADRPTEILLQYPSASLK
ERFNLVVPRDNDDFKPIDDIVHVIDIVSENYIPESEADFFNNESTGIKRRLRRALAHSSE
TEFREAVASYNREIERLRRSGAIAKHLDATHRLNLPLVERILTQIYARTVSPRVESLRRY
ENGTDNVYGELLPRFISTIFKETRLKSGHVFVDLGSGVGNVVLQAALEIGCESWGCEMMA
NACDLAELQQTEFRARCRLWGIAPGKTNLVRGDFLQEQSIIDVLKRADVVLINNQAFTPQ
LNNEIINHFLDMKEGCQIVSLKSFVPAGHKIQSRNLYSPINLLKVKQLNYWSNSVSWTDV
GGTYFIATKDSSRLKAFADSME
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgggatttttcgatcacctccagaaaggaggggctttttcgctgcaggctcaaaagcca
caaattcgtaaggttgtccagacccggcccccgccgccctcaagatcttcctcgcacacc
cccgtcagatcattgtcgcagacctcacccccggggagagttaaaagaccacgagactcc
actagccggtctgtctcgagagatcccgatcatcgcccatcgaagcgtttaagtaccccg
ttgcgaaataggaaacggccaactcctgaacaacggttttcgagtgacgatgacgcaagt
gacacggatacatcatttgagttgcgcaagcgggcaagaacggaggatagtgcggagcct
gacctcgcgaggcgcatacggtctttgaaagcattttcggaggagaatgttaaaccactg
ccattggtccacgctgcagatattacatccaaacaaaaagccggaaacttcagacgagcg
tttggaggggcagaccggccgacggagattcttctgcagtatcccagtgcttcacttaaa
gaaagattcaacctcgtcgtgccacgcgacaacgatgattttaagcctatcgatgatatc
gtccatgttatcgacatcgtttctgagaactatattcctgagagtgaggcggatttcttc
aacaatgagtcaacaggtatcaaacggaggttgcgccgagctttggcacattcgtcagag
acggaattccgagaagccgtggccagctacaatcgtgagatcgagcgtttaagacgtagt
ggggccattgctaaacatttggacgcgacacatcggttgaacctgccgcttgtagaaagg
atattgacacagatttacgcccgtactgtatcccctcgagttgaatctcttcgccgatac
gaaaacggaacggataacgtttacggagagctcctacctcgtttcatcagcacgatcttc
aaagaaactcggctaaaatcggggcacgtctttgtcgatcttggatctggagttggtaat
gtcgttttgcaagctgcgcttgaaattggatgtgaaagttggggctgcgagatgatggcc
aatgcttgtgacctggcagaacttcagcagaccgagtttagagcacgctgccggctctgg
ggtattgcgccagggaaaacaaaccttgtccgtggcgactttctgcaagagcaaagcatc
attgatgttctgaaacgcgcagatgttgttctgatcaacaaccaagcctttacacctcaa
ctcaacaatgagatcatcaatcacttcttagatatgaaagagggctgccagattgtgtca
ctcaagtctttcgttcctgccggtcacaagattcagtctcgcaatctgtactccccgatc
aaccttttgaaggttaagcagttgaattactggtcaaacagtgtcagctggactgacgtt
gggggcacatattttattgccaccaaagatagttccaggctcaaggcttttgcggatagc
atggaatga

DBGET integrated database retrieval system