KEGG   Aspergillus fumigatus: AFUA_5G12260Help
Entry
AFUA_5G12260      CDS       T01017                                 

Definition
disulfide isomerase (TigA) (EC:5.3.4.1)
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
afm  Aspergillus fumigatus
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:afm04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 368 aa AA seqDB search
MARLSFLLVSCLTLLVGIASATSAVIDLLPKNFDDVVLKSGKPALVEFFAPWCGHCKNLA
PVYEELAQAFEFAKDKVTVAKVDADEHRDLGKRFGVQGFPTLKWFDGKSDKPEDYKGGRD
LESLSAFIAEKTGIKPRGPKKEPSKVEMLTESSWKSTIGGDKNVLVAFTAPWCGHCKNLA
PTWETLANDFALEPNVVIAKVDAEAENSKALAKEQGVTGYPTIKFFPKGSTEPITYSGAR
SEEAFIEFLNANAGTNRVVGGGLNEKAGTVAVLDEFINKYISSRNAEELVAEVKKAAKGL
QDKYAQYYVKVAEKISQNEEYASKELARLKKILEKGGSAPEKLDDIVSRSNILRKFVGEK
DTDAKDEL
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggctcggttgagcttcctgcttgtgagctgcctcacactgctcgtcggtattgccagc
gccacttccgccgtcattgatctacttcccaagaacttcgacgatgtcgtcctcaagtcc
ggaaagcccgctcttgttgaattcttcgccccttggtgtggccactgcaagaacctcgca
cccgtctatgaggagctcgctcaggctttcgagttcgccaaggacaaggtgactgtggct
aaggttgatgcggacgaacatagagatcttggaaagagatttggtgtccagggattcccg
accctgaagtggttcgatggcaagagtgacaagcccgaggactacaaaggtggtcgggat
ctggagagcctgtctgcgttcattgcggagaagacgggcattaagcctcgtggaccaaag
aaggagcctagtaaggtcgagatgctgactgagtcttcgtggaagtctaccattggtggc
gacaagaatgtgttggttgctttcactgcgccttggtgcggacactgcaagaacctcgcc
cctacttgggagaccctcgccaatgacttcgctctcgagcccaacgttgtgatcgccaag
gttgacgctgaggcagagaattccaaagccctcgctaaagaacaaggcgtcaccggatac
cccaccatcaagtttttccccaagggctcgactgagcccatcacttacagcggtgctcgt
tccgaagaagccttcatcgagttcctgaacgccaacgctggtactaaccgtgttgttggt
ggaggtctcaacgagaaggccggcacagtcgccgttttggacgagttcattaataagtac
atctcgtcgcgcaacgccgaggagctggttgcggaggttaagaaggctgccaagggtctt
caggacaagtatgctcagtactatgtcaaggttgccgagaagatcagccagaacgaggag
tatgccagcaaggagttagctcgtctcaagaagatccttgagaagggtggctcggccccc
gagaagcttgacgatattgtttctcgcagcaacatcctgcgcaagtttgttggcgagaaa
gacactgatgccaaggacgagctataa

DBGET integrated database retrieval system