KEGG   Aspergillus fumigatus: AFUA_5G12670Help
Entry
AFUA_5G12670      CDS       T01017                                 

Definition
nuclear pore complex subunit Nup192
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
afm  Aspergillus fumigatus
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:afm00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    AFUA_5G12670
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 1622 aa AA seqDB search
MEDGDTLVGLRGLYQDLSALSDSSFVNIERLRVELETHIEDFKKLLDKPSKNNTSRQAVL
SGKITVDDVEYSINQDFQQGALQLADALNIDELEAAVLFFAAQEEAQVLDRPPLIAAIMR
FHERRHFLLECLRLILQESFEVEREVTQALMQDMVAFIVEIKTGPLRNASLFARKCMKSM
EDIEGWLLLLGEQIQKASIVGQVEDRDVMEAIEYQRSSLQQQHESLGAILCYFFKGPYTS
PEDLRVLLNRLRKLERFDGLLLHYIPAMISSFVQHGSPERSNSYKEARSLHLAVTSTKDG
QTWTIPTFHAAVIALWLAVYSGWDIDGPTSPVQGVDFEKEAEERTQMFMTALDDGGLDFL
LAICSGVNNEEWADPARRELVALLLKESAFANLESEPCAGFLKTLLMENLEIFVESCIAN
MPDAVRKLKSEEDMQRLDQITALRDGLSSSLHRGLVEARTHLESFLMIIAFAFESRPDAA
QEFWADPDGNLYGFLQWASKRQTVPRVSAFCELLCSISGGEENAAAAHRFLTEEDKFLSS
KFKRSTSMNWSQMFAELQLYATRVTEKPSASQAVLRARKSEPADMSEPESPVMLTCYLRL
MGHLCKQSGSIREWMLQHPSFSVVSTLLTLCSGPIPTHLRATVFTTLAALMTDRTSHNGN
EMWLSLDQWISGGAMSGPGLGKVPIVSNPLVWHEQQAFQKIGESFDQANAFVVLIYSLIT
PTSDSTEYHLSLPFPESLGSSYRMPGIEPYIDFVMGQALSRKVPDLGERQTRLLTYNCLS
FVITCLRSFNENIVTVLSQPTISSDSSLKTSSLTTYIRLHPFARVAEWLFNEDVIKAIFA
TAQQDASEVANAASDSILIQCLVKSIEVMDLMLDLQSTYFHIVRPSIKSQAGGSRINVAN
SSLSSFEDSILNNLTIIPALSLYCGAGHEQLTVTSMALLEKMSSSRKLNKLSSPEISNWQ
SSNKIVEVLSTEVDVDSVSRPLVSQMQPELRELELGARSPGYIIRESLLALLNSCLSMIT
DRPTIAHLFLGFSSVGTMLDISPNSLFSNGMSLLHAIIGFLQSYPDAMEGNILPWMVHLR
RMALEVLKHLWSSKIASAFTLLEMRSSRFLLSMFASQPIIGPDTPFDGLSVMDEEFWISE
STSALAEFLLFRSYLYAYAATEIRAAAKLGSQTLQTEILSTLLGNSTTETGETILNPTVF
DLFDFADLDLSHKIPAPRLVFLDGIGFDVCAKSQADESLVLYNLAEVAELIQVRKEELLS
SGQLRPQDEEQFSAEAEGLTLFIRATNQARQIAFNRYLALRSWTELITTMLACSEIEGGR
KPTFILHSIQLVLPKLEAAIEEDLPEAIELARLAETLIGGLEFTSTSTDGARRSGDIIDE
KLHQLFQICIRGIFLASGNVQLRETFYNIGSQYISRIASADTVNQNLRHHSQQVIKTAGS
TLIETTCDDAYAGQEACRVSALLFLNLLATLDRETDSTLAELISQSNYLSLFLDAIRALP
HELKNTQANDIDNPDALRKYYDLLGSVLRVIISAVFSRGLHNEQIMQQTRAFLAENRQSM
VGIFKRFAKIGGVGTADHHDALSDLAKCYMTLISATNFLEVCSQAAIITADANREPSTRT
RK
NT seq 4869 nt NT seq  +upstreamnt  +downstreamnt
atggaagacggagataccctggttggccttcggggcctgtaccaggatctgtctgctctt
tcagactcgtcatttgtcaacattgaacgacttcgtgttgagttggaaactcacattgag
gatttcaagaaactcttagacaaaccctcgaagaacaacacaagtcggcaggctgttctc
tcagggaagattaccgttgacgatgtcgaatattcaatcaaccaagactttcaacaaggc
gcactacagcttgcggatgctctcaacattgatgaactggaggccgctgttctattcttt
gcggcgcaggaggaagctcaagtactggatagacctccgctgatcgcggcaattatgcgc
tttcatgaacggcggcacttccttcttgaatgcttacgcctgattcttcaagaatcgttt
gaggttgagcgggaagtgacgcaagctctcatgcaagatatggtggcattcatcgtggag
atcaaaactggacccttacggaatgcatcgctttttgcgcggaagtgcatgaagtctatg
gaggatatcgagggatggttgctgctccttggggagcagattcaaaaggcatccattgtc
ggccaggtggaggatcgcgatgttatggaagccattgaataccaacgcagcagcctgcag
caacaacacgagtcattaggcgcaattctgtgctatttcttcaaaggaccttataccagc
cctgaggaccttcgggtgctcctgaatcgcttaaggaagctcgaaagatttgatggactg
ctgcttcactacatccctgctatgatatcgtcgtttgtccagcacggctcaccagaacgg
tcgaattcatacaaagaggccaggagcctgcacttggcggtcacctctaccaaagatggc
caaacttggacgatcccgacgtttcacgcagctgtcatcgcgctttggcttgcggtttac
agtggctgggatatcgatgggccgacctctcctgtccaaggggtcgacttcgaaaaagaa
gcagaggagcgaactcaaatgttcatgacggcactcgacgacggaggactcgatttctta
cttgctatctgctcaggtgtgaacaacgaagagtgggctgacccggctcgccgtgaatta
gtggcgctattgttgaaagaaagcgcattcgcgaatttggaatccgaaccctgtgctgga
tttttaaagactctactgatggagaacctagagatttttgtggagtcttgcattgccaac
atgccagatgcagttcgaaagctgaaatccgaggaggatatgcaacgcttggatcagatt
actgccttgagggatggtttgtcgtccagcctccatcgcggcctggtcgaagctcgcact
catctcgagtctttcctcatgatcatagcattcgcattcgaaagccgaccagacgcagct
caggagttctgggcggacccagacggcaatttgtatggtttccttcaatgggcttccaaa
agacagactgttccgagagtcagcgccttttgcgagttgctgtgttctatttctggcgga
gaggagaatgccgctgctgcacatcgatttctaaccgaggaggacaagttcttgtcgtcc
aagttcaagcgatccacttccatgaattggtcccagatgtttgctgaactccaattgtac
gcgacgagggttactgagaagcctagcgcttcccaagcggtcctgagggctcgaaagtct
gaacctgccgacatgagcgagccagaaagccctgtcatgctgacttgctatctgcgatta
atgggtcatttatgcaagcagagtggctccataagggaatggatgcttcagcacccatct
ttcagcgttgttagcaccttgttgaccttgtgcagcggccccatacccacccacctgagg
gccactgttttcactacccttgcagctttaatgacggacagaacgtcccacaatggcaac
gagatgtggctctctcttgaccaatggatttccgggggcgccatgagtggccccggcctt
ggtaaagtgcccatagtgtcaaatccattggtgtggcacgagcagcaggcattccagaag
atcggcgagagttttgatcaggccaatgcctttgtcgtcttgatttactcgctcatcacc
cctacctctgactccacagagtaccatctgtccctgcccttccccgaatctctaggatcc
tcctatcgcatgccaggtatcgagccgtacatcgattttgtcatgggtcaggccctctcg
aggaaagttccagatctgggcgagcgccaaactcgccttctgacctataactgcttgagt
ttcgtcatcacgtgcttgagatcgttcaacgagaacattgtaactgtcctcagccaaccc
acaatcagctccgattcttccctgaaaacgtcatccttgaccacctatatccgtcttcac
ccgtttgcgcgtgtggctgagtggctattcaatgaagatgttatcaaggcgatcttcgca
acagctcagcaagacgccagcgaggttgccaacgccgcgtctgactctatacttattcag
tgcttggtcaaaagcatagaagtcatggacctgatgctggatctgcaatcgacctacttc
catatcgtccggccgtccatcaagtctcaggcaggtggaagcagaatcaacgtcgctaat
tcgtcgctttcatccttcgaggatagcatcctcaacaacttaacgattatacctgctctg
agcctttattgcggcgcgggtcacgagcaacttaccgttacctcaatggcacttctggag
aaaatgtcaagctctaggaagttgaacaagttgtcgtcaccagaaatatcgaattggcaa
tcctcaaacaaaatagttgaagtcctgagcacagaagtggacgttgacagtgtttcacgg
ccgctggtgtctcagatgcaacctgaattgagggagttggaacttggtgcacggtcccca
ggctatattattagggaaagccttttggcactcctaaatagctgtctcagcatgatcacg
gatcggccgactattgctcatcttttcctcgggttcagtagcgtgggaaccatgctggat
atttctccgaatagtctgttctcaaacggaatgtccttgttacatgctatcattgggttc
ttgcagagctaccctgatgcgatggaagggaacattcttccttggatggtacatctacgg
cgtatggcccttgaagttctcaaacatctatggtcctccaagatcgcgtctgcgttcact
ctgcttgagatgcgttccagccgctttctactcagcatgtttgccagccaacctataatc
ggaccagacactccttttgatgggttatctgtcatggacgaagaattctggatctctgag
tccacatcagctcttgctgagttcttactttttagaagttacttgtatgcctacgcggcg
accgaaattcgcgcggccgccaagctcggctcgcagacacttcagacagagatcctttcg
acgttgcttgggaactcaaccacagagacgggggagacaatcctcaatcccaccgtcttt
gatctctttgattttgctgacttggatctcagccacaagattccagcgcccagattagtc
ttccttgatgggattggctttgatgtgtgtgcgaaatcgcaagcagacgagtcgcttgtt
ctgtacaatctagcggaggttgcagagctcatccaagtcagaaaggaagagttgctgtcg
agtgggcagttgcgacctcaggatgaagagcaattctcggccgaagctgaaggcctgacg
ttattcattcgtgcgacaaatcaagcaaggcaaattgcgtttaaccgttacctggctctt
cgatcatggacagagctcatcacaacgatgctggcttgttctgagattgagggtggccga
aaaccaacatttatcttgcattcaatccagttggtcctccctaaactcgaagcagccatc
gaggaggacctaccggaggcaatcgagcttgcacgactcgccgagactcttatcgggggt
ctcgaatttacgtccacgagtacagacggtgcacggcgaagtggggatatcatagacgaa
aaactgcaccagctgttccagatctgcattagaggtatcttcctggcaagtggaaatgtt
cagttgcgtgagacgttttacaacatcggttcccagtacatcagtcgtatcgcctccgcc
gatacggtgaatcagaatctgaggcaccacagtcaacaagtgataaagacagcgggatct
accctgattgagaccacctgtgacgacgcatacgccgggcaagaagcatgtcgggtgtcg
gctctgctatttctcaatctgctggccactctggatcgagaaacagactcaactctggca
gagttgatctcacaatcgaattatctcagtcttttcttggacgccatcagagcgctacct
cacgaactgaagaacactcaagcaaatgatattgacaaccctgatgctcttcggaaatat
tatgatcttcttggctcggtactccgggtcattatctcagctgtcttctctcggggtctt
cataatgagcaaatcatgcagcaaacacgagctttcttggcagaaaacagacagagcatg
gtcggcatcttcaagcgatttgctaagatcggtggagtaggtactgctgatcatcacgac
gcgctgagtgatttggccaagtgctacatgacgctcatcagcgccaccaacttcctagag
gtatgtagtcaagccgccataataactgcggatgctaatagagaacccagtacgaggacg
aggaagtga

DBGET integrated database retrieval system