KEGG   Aspergillus fumigatus: AFUA_5G13180Help
Entry
AFUA_5G13180      CDS       T01017                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
afm  Aspergillus fumigatus
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    AFUA_5G13180
Enzymes [BR:afm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     AFUA_5G13180
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 391 aa AA seqDB search
MITSTLSLLALSAIASAHSDHRQKTIAGPHQSLWYNTIPGDGGTQADSVFSGISTFGRLP
YFPCLSSEAEKYDIAFVGAPFDTGTSYRPGARFGPSGIRQGSRRLNLYGGYNVPLEANPF
VSELKVLDCGDIPVTSYDNAWAIQQIEEGHNSLLMRKPFTDADAEGLSRAGKTLPRIITL
GGDHTITLPLLRSINKAYGPVTVIHFDSHLDTWKPKVFGGSPSQVAAINHGTYFYHAAME
GLLKNDTNIHAGIRTTLSGPSDYENDGYCGFEIVEAREIDTIGTEGIIKKIRDRVGTENP
VYLSIDIDTLDPAFAPATGTPETGGWSTRELRTIIRGLDGLNFIGADIVEVAPAYDTNAE
LSTMAAADVLYEVLTIMVKKGPLSLSKGHEL
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgatcacttccacgctcagtcttttggcgctttccgccattgcgtctgcgcatagcgat
catcggcaaaagaccatcgctggcccgcatcaaagtctctggtacaatactatcccaggc
gatggtggtactcaggccgactccgtcttctctggcatctcgacgttcggtcgtctgcct
tacttcccttgtctgtccagcgaggcagaaaaatatgatatcgctttcgtcggcgctccc
tttgataccggcacatcatacagacctggtgcaaggttcggcccgagtggcatcagacaa
ggttctcgccgtcttaatctctacggtggctacaatgtaccgctggaagcgaatccattc
gtcagtgagctcaaggttttggattgtggtgatattccggtgacgtcatacgacaatgct
tgggccatccagcagattgaagaaggacataacagcctgctgatgcgcaagcctttcacc
gatgcggatgcggaaggactgtccagggccggaaagactctgccgcggattatcactctg
gggggtgatcataccatcacactgccgttgctgcgcagtatcaacaaggcttacgggccc
gtgactgtgatccatttcgacagtcatctggacacatggaagcccaaggtctttggcggc
tcgcccagccaggttgctgctatcaaccacggaacctacttctaccacgctgccatggaa
ggcctcctgaagaacgacaccaacatccatgccggcatcaggacgaccctttctggtccc
tctgattatgagaatgacgggtactgcggcttcgagatcgtcgaggcgcgcgagattgac
acgatcggaaccgaaggaatcatcaagaagatcagagatcgagtcggcacagagaacccc
gtctacctttccattgacatcgataccctggaccctgcttttgcaccggcaaccggtacc
cccgagactggaggctggtcgacccgtgagctccgcaccatcatccgtggccttgacggc
ctcaacttcatcggtgcggatatcgtcgaggttgctccagcttatgacacaaatgcagag
ctttctaccatggccgctgcggatgttctctacgaggttcttaccatcatggtcaaaaag
ggaccattgtctctgtccaagggacatgagctgtag

DBGET integrated database retrieval system