KEGG   Aspergillus fumigatus: AFUA_5G14090Help
Entry
AFUA_5G14090      CDS       T01017                                 

Definition
cell-associated beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
afm  Aspergillus fumigatus
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:afm00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:afm00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:afm00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 976 aa AA seqDB search
MGWQSRMIQSKALIDICDIFTMRESILSVLTFFSLLLVVQARDDGRMKYNFNSGWKVLVG
NPASAQSPSFNDNDWKDVTLPHAWNEDDAFRVDIANLSTGIAWYRKHFDLPATSRNKKVF
LEFEGIRHAGEFYLNGKWIGRSENGVMAFGFDVSDITLYNQTNVLAAQIDNSWTYREKAT
STPYQWNDKNFYANYGGINKNVFLHVTDRLYQTLPLYSNLQTTGVYIYATDLDIPRKSAT
INVESQVRNEYQQARTFQYQVDIHDAVQGKKLKTITGGRYTLQANETRTIRTTTHLSDLN
FWSWGYGYLYDVRTSLLLNHHAIDSVKTRTGFRKTEFTHGAFKLNDRTLHLKGYAQRTTN
EWPALGCAVPPWLTDFSNSLVLASNAALIRWMHVTPWKQDVESLDRLGLLQALPAGDSEG
DATGRRWAQRTELMRDAVIYHRNSPSVIFYEAGNHGISEAHMSEMKALRDTYDPHGGRAA
GSREMLNSSVAEYGGEMLYINKGARIRLWQMEYSRDEGLRKYWDDWSPPYHVDGAGPPYK
GEDASEYNRNQDSHAVENVRRWFDYFEQRPGTGTRVNAGGVNIIFSDSNTHHRGAENYRR
SGEVDGVRLPKDGWYAHKVMWDSWVDVDRLAGHIIGHWNYNDTTVKDFYVVSTAEEVELF
LNGKSVGKGEQSSRFLFTFANVTWQPGTIRAVGRLDARESLLDTKTTAGEPASIRLTPHT
GPSGFVADGADIAVVDVEVVDAEGQRNPIALNIIDFALSGEASWRGGIAQCADNCILSTT
LPVENGINRVMLRSTTRAGQVTLTATSDGLKPATISLNTKPFASKGGLSTVIPGSDLPFV
LSRGPTPSSESYTISRKAVEGLNVTAGCDTENMINSYDDDEETEWSCDGDKSSTWIKYSW
DSPVNVSQMVMKLHSFRTTKYPVQISVDDTVVYEGVTPTSLGYVTLDLNATVGQSVTVAS
EDSDLGIIEAEIYTPA
NT seq 2931 nt NT seq  +upstreamnt  +downstreamnt
atgggttggcagtcgaggatgatacagtctaaggcgttgattgatatctgcgatatattc
acaatgagagagtccattctttcagtccttacgttcttctccctcctgctcgttgtccaa
gcaagagatgatggccggatgaaatacaacttcaactctgggtggaaagtactcgtgggc
aatcccgcgtccgcacagtcgccgtccttcaacgacaacgattggaaggacgtaaccctc
ccccatgcgtggaacgaagatgatgctttccgcgtggacattgccaacctgtccaccgga
attgcctggtaccggaaacactttgacctgccagccacgagccggaataagaaagtcttt
ctcgagttcgaaggcatccgtcacgccggggagttctaccttaatggcaagtggatcggt
cgcagcgagaacggggtcatggcctttggctttgatgtcagcgatatcacgctctacaat
cagaccaacgtcctggcggctcaaatcgacaatagctggacgtacagggagaaggccacc
agcacgccgtaccagtggaacgacaagaatttctatgccaactacggcgggatcaacaag
aacgttttcctgcatgttacagatcgactgtaccagactctaccgttgtactccaatctg
cagaccaccggggtttacatctatgccaccgacctggatataccccgcaagagcgctacc
atcaacgtagaatcacaggtccgcaatgagtaccaacaagccagaacattccagtaccaa
gtcgacatccacgatgccgtgcagggtaagaaactcaaaaccatcaccggcggccggtac
accctccaagcgaacgagacccggaccatccgcaccacaacacacctctcggacctgaac
ttctggagctgggggtacggctacctctacgacgtccggacctcgctactcctcaaccac
cacgccatcgactccgtcaagacccgcaccggcttccgcaagaccgagttcacccacggc
gcgtttaagctcaacgaccgcaccctccacctcaaaggctatgcccaacgcacaacaaac
gaatggcccgccctcggctgcgccgtcccaccctggctcaccgatttctcgaacagcctc
gtcctcgccagtaacgccgccctcatccgctggatgcacgtcaccccatggaaacaagac
gtcgagtcgctcgatcgcctgggcctgctccaggccctgccggcgggcgactccgaaggc
gacgcaacaggccggcgctgggcgcagcgcacggagctcatgcgcgacgcagtcatctac
caccggaacagccccagcgtcatcttctacgaagccggcaaccacgggatctcggaggcg
cacatgagcgagatgaaggctctgcgggatacgtacgacccacacgggggtcgcgcggcg
ggatcgcgcgagatgctgaatagctctgtggcggagtacgggggcgaaatgctgtatatc
aacaagggggcgcgcatccgcctctggcagatggagtatagtcgtgacgaggggttgagg
aagtactgggatgactggtctccgccgtatcatgtggacggggcgggcccgccgtacaag
ggggaggatgcgagcgagtacaaccgcaaccaggactcgcatgcggtggagaatgtgcgg
cgatggttcgactatttcgagcagcggcccgggacggggacgagggttaatgccggtggg
gtgaatattatattttcggactcgaatacacaccatcgaggagcagagaattaccgacgg
tctggcgaggtggatggggtccggctgccgaaggacgggtggtacgcgcacaaggtgatg
tgggatagctgggttgatgtcgaccggttggcaggacatatcatcgggcattggaactac
aacgacactacggtcaaggatttctacgttgtgtccacggcggaggaggtggagctgttt
ctgaatggcaagtctgtgggcaagggcgagcagagcagccgattccttttcactttcgcc
aatgtcacttggcagccgggcacgatcagggccgtgggacggctggacgctcgtgaatcc
ttgctggacacgaagacgactgctggtgagcccgccagtatccggttgacgcctcatacg
gggccgtctggatttgtggctgatggtgcggatattgccgtggtggatgttgaggtggtc
gatgcagagggtcaaaggaaccccattgctctgaacatcattgactttgctctttctggg
gaggcctcctggcgtggcggaattgcccagtgtgccgacaactgcatcctgtcaactacc
ctcccagtcgaaaacggaatcaaccgggtcatgctgcggtctacaacaagagccggccag
gtcactctgactgctacatccgacgggctcaaaccagcaacgattagcctcaacaccaag
ccatttgccagtaagggcgggttgagcaccgtcatccccgggtccgaccttccttttgtt
ctctctcgcggtccgacaccatcgagtgaatcatacaccatatctcgcaaagctgtggag
ggtttgaacgtcactgctggatgtgacacggagaacatgatcaattcctacgatgatgac
gaggaaacagagtggtcctgtgacggggacaaaagcagtacctggatcaagtactcctgg
gacagtccagtcaatgtgtcgcagatggtgatgaagctgcacagcttccgaacgacaaag
tatccagtccagatcagtgtggacgacaccgtagtctatgaaggggtcaccccgacttct
ctaggctatgtgacgttagatctcaatgctactgttggccagagtgtgacggtggcttca
gaggacagcgacctgggaattatcgaggcggagatctacacaccggcataa

DBGET integrated database retrieval system