KEGG   Aspergillus fumigatus: AFUA_5G14550Help
Entry
AFUA_5G14550      CDS       T01017                                 

Definition
beta-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
afm  Aspergillus fumigatus
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AFUA_5G14550
  Lipid metabolism
   00600 Sphingolipid metabolism
    AFUA_5G14550
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    AFUA_5G14550
Enzymes [BR:afm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     AFUA_5G14550
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 1055 aa AA seqDB search
MTLSAVPDYENQHILQRNRLKPRAYFLPATSISLNGRWDFHYAASPVSAPEPTWSKGTKN
ATAEPRRDSNQFSSDGADSKTAWAPITVPGHWQLQGYGRPHYTNVIYPFPVCPPFVPTEN
PTGTYRRTFHVPAEWDASSQLRLRFDGVDSAYHVWVNGVPIGYSQGSRNPAEFDVSQVVD
RDGANELFVRVYQWSDGSYIEDQDQWWLSGIFRDVTLLAFPGQARIEDFFVRTALDKDYV
DATLRLSVDLALATAAIVQVTLSNPSTGSTLQTEKYSLGEKQDKLEAELSVSNPNKWTAE
TPNLYNLCIALYVDGAKDPVQTINHRVGFRQVEIKNGNITVNGVPVMFRGVNRHDHHPRF
GRAVPLSFLREDLLIMKRHNVNALRCSHYPSHPRLYELCDELGLWVMDEADLECHGFYDA
IARPLDIPESMDYEERKKLTFGQAAQFTTNNPEWKEAYVDRMAQMVQRDKNHSCIVIWSL
GNEAFYGSNHQAMYDYVKQVDPSRPVHYEGDMEAKTVDMYSYMYPSLERLVGFATAEGDE
FKKPIVLCEYAHAMGNAPGGLEEYMEAFRTHRRLQGGWVWEWANHGLWDEKKGWYGYGGD
FGDTPHDGNFVLDGLLFSDHTPTPGITELKKAYAPVRVWPGEDGTLVVANDYNFVGLEGL
QASYKIEVLGDSGRIIATGIIELPPIPAGQNGTIKLPSAPATAIPGEVWLTISFLQKGET
AWAGNNYEVAWYQQCLKSSSPRFSLAVPAEALTHSSTKTSHRISGASFSLEFSRETGSLY
AWTAGGLSLLDQSSSTGAISPGFWRPPTDNDMSHDLLEWRRFGLDTLTSQLRKMHVVQHT
PTSVEVTTETYISAPILGWGFFASTSYTISGNGALTVNVHLKPHGPMPADLPRLGLDVLL
ADELDNTSWFGLGPGEAYPDKKRAQKVGIYNAATAELHTPYEVPQEGGNRMDTRWLRVHD
SRGWGLRVTRVKDESDKQPTELFQWLATRYSPEAIEAAKHAPELVPEKRIRLRLDVESCG
VGTGACGPRTLDKYRVKCEERKFGFTLQPVLAELC
NT seq 3168 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgtccgcagtccccgactacgaaaaccagcacatattgcagcgcaatcggctc
aaaccaagagcatatttccttcccgcgacgtctatctcgctcaatggtcgctgggacttt
cactatgcagcctctcccgtgagcgccccagagccaacatggtccaagggcaccaagaac
gccacggccgaaccccgccgggattcgaaccaatttagctcggatggcgcagactccaag
acagcttgggctccgatcactgttcccggccattggcaattgcaaggctatggccgtcca
cactacacaaacgtcatttaccctttccccgtctgtccgccatttgtgccgacggagaat
cctacgggcacctaccggcggaccttccacgtgcctgccgagtgggatgcttcgtcccaa
ttgcgactgaggttcgatggcgttgacagcgcgtatcatgtgtgggttaatggtgtcccg
attgggtattcgcaagggagccgtaacccggccgaattcgatgtgtcgcaagtggttgac
cgcgacggcgccaatgaactgtttgtcagagtgtatcagtggtccgatggctcgtatatc
gaggaccaggaccaatggtggttgtcaggcatttttcgcgatgtgaccctgctggccttc
cctggccaggcgcgcatcgaagacttcttcgtgcgcaccgcactggacaaggattacgtc
gacgcgacattgcgtttgtcagtggatctagctctggcaacagcagccatcgtgcaagtg
actctgagcaatccgtccacgggcagtacgctgcagacagagaagtattcgctcggggaa
aagcaggacaaactcgaggctgagctttccgtctccaacccgaacaaatggacagcggag
acacccaacctctacaatctgtgcatcgctctctacgtagacggtgccaaggaccctgtt
cagacgatcaaccaccgtgtcgggttccgtcaggttgagatcaagaatggcaatatcact
gtgaacggcgtgccggtgatgttccgcggcgtcaaccggcacgaccaccatccacgcttc
ggtcgagcagttcctctgtccttcctgcgcgaggacctcttaatcatgaagcggcataac
gtcaatgctctccgctgctcgcactacccgtcccacccccgtctatacgaactctgcgac
gagctcggcctatgggtaatggatgaggcagacctggaatgtcacggcttctacgatgcc
atcgctcgccccctagatatccccgagtccatggactacgaggagcgcaagaagctcacc
ttcggccaggcggcgcagttcaccacgaacaatcccgagtggaaagaggcgtatgtcgac
cgaatggcgcagatggtgcagcgcgataagaaccattcctgtatcgtcatctggtcgctc
ggcaatgaggcgttttatggctctaaccaccaagccatgtacgactatgtcaagcaggtt
gaccccagtcgtccggtgcactacgagggagacatggaggccaagacggtcgacatgtac
tcgtatatgtatccatccctcgagcgactagtcggttttgctactgccgagggagacgag
ttcaaaaagccaatcgtgctttgcgagtatgctcacgcgatggggaatgctcctggtggc
ttggaagagtatatggaagcctttcggacccaccggcgtctgcaaggagggtgggtctgg
gagtgggcaaaccacgggctctgggacgagaagaagggatggtatggctacggtggtgac
tttggcgatacgcctcacgatggcaactttgtgctggacgggctgctattcagtgaccac
accccaacgcctggtatcactgaactcaagaaggcctatgcgccggttcgggtgtggcct
ggtgaggacgggactctggttgtggcgaacgactacaattttgttgggttggaaggtctc
caggcatcttacaagattgaggtcttgggagatagcgggcgcattattgccacaggcatt
atagaacttccgcctattcctgccggccagaacgggactatcaagctgccatctgcgcct
gctaccgcaattcccggggaggtgtggctcaccatcagcttccttcaaaagggagagaca
gcatgggccggaaacaactatgaagtcgcctggtaccagcagtgcctcaagtcctcctca
ccacgtttctcattggccgtacctgctgaggccttgacgcactcatccacgaaaacgtca
cacagaatctccggtgcctcatttagcctggaattttcacgagaaacgggcagtctctac
gcctggacagccggcggcctctccctcctcgaccagtcctcatccaccggtgccatctct
cccggattttggcgcccaccgaccgacaacgacatgtcccatgacctcctcgaatggcgg
cgcttcggactcgacactctcacctctcagctacgcaagatgcacgttgtacagcatacc
ccgacgagcgtagaagttactacggagacatacatctccgcgccaattctaggctgggga
ttctttgcctcgaccagttatactatctccggcaatggcgctctaaccgtcaacgtgcac
ctcaagccccacggcccaatgccagcggacctgccccggctcggcctggacgtactgctt
gcggatgagctcgacaacacctcgtggttcggcctgggacccggcgaagcgtaccccgac
aagaagcgagcgcaaaaggttggcatttacaacgctgccacggcggaattgcatacccct
tacgaagtaccacaggaagggggcaaccggatggacacccggtggttacgtgtgcacgac
agcaggggatggggtctccgggtgactcgcgtcaaggacgagagtgataagcagccgact
gagctgttccagtggctagctacgcggtacagcccggaggctattgaggcggccaagcat
gcgcctgaacttgttcctgagaaacggatccgattgaggctggatgtggagagctgcggt
gttggaacgggagcttgtggccctcgtacccttgacaagtaccgggttaaatgtgaggag
aggaagtttggctttactctgcagcctgttttggccgagttgtgttag

DBGET integrated database retrieval system