KEGG   Aspergillus fumigatus: AFUA_6G02380Help
Entry
AFUA_6G02380      CDS       T01017                                 

Definition
(RefSeq) ubiquitin C-terminal hydrolase (EC:3.1.2.15)
  KO
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.4.19.12]
Organism
afm  Aspergillus fumigatus
Brite
Enzymes [BR:afm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     AFUA_6G02380
Peptidases [BR:afm01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   AFUA_6G02380
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 571 aa AA seqDB search
MFSVIVKHQGKRHEVELDPSANGETLKYQMYSLTGVEPERQKILVKGGQLKDETPLSALN
AKPGQTFMMMGTPSGGQDAVDLGRPKEPVKFLEDMTEAEAARAEGAIPAGLQNLGNTCYL
NSTLQTLRSVPELQQELLNYKPSAGSSAGSRLSDLSSLGLGGLGASMDLVSSLRDLFKQM
SETQEGFPPLMFLNALRSVFPQFAQKDRNGHGYAQQDAEEAWSQIVTQLRSKLVIKEGEG
DSATEVSFVDKFLAGRFESVTECDDPAAKAAGEEATKSSDIFFKLDCHIGKETNHLHDGI
LAGLEEKIEKRSPTLDRDAVYTKRSRIARLPKYLTVHFVRFFWKRETQKKAKIMRKVTFP
AELDVVEFCTEELKKQLIPIRDKVRDIRKEEVDVERARKRQKLAHQREEELKRAAESDAG
LEPLQKKKATEGQKEATKSGEQDGDTAMTDVFKSDAEYEAEKYASILAAKKELAALIDPK
LASDAGTNNSGLYELRAVITHQGASADSGHYTSYVKKQPNGKGVEDGKWWWFNDEKVTEV
DGEKIETLAGGGESHSALILLYRAVDLPTAE
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgttctcagttatcgtgaagcatcaaggcaaacgtcatgaagtcgagctcgatccgtct
gcaaatggcgaaacgctgaaatatcaaatgtactccttgactggagttgaacccgagaga
cagaagatcttggtcaagggtggccagctgaaagatgagacgcctttgtccgccctcaac
gctaaaccaggtcagacatttatgatgatgggtacaccgtctggcggccaagatgcggta
gacttgggacggccaaaggaaccagtcaagtttcttgaggatatgaccgaagccgaggcg
gccagagcggagggtgccattcctgctggtctacagaatcttggaaatacttgctacctc
aactctaccctacaaaccctgaggagcgtcccggagcttcaacaggagctcctaaattac
aagcccagcgcgggctcttcagcgggttcaagactttcagatctcagcagcctgggcctt
ggtggtcttggtgcctccatggatcttgtatcctccttgcgcgatttgttcaagcagatg
tccgagacgcaagaagggttcccaccacttatgtttctcaatgctttgagaagcgttttc
cctcaatttgctcagaaagacaggaatggtcatggctatgctcaacaagacgctgaagag
gcttggtcgcaaattgtcactcaactgcgaagcaaactggtgatcaaagagggcgaagga
gattccgctaccgaggtgtcgtttgtggataaatttcttgctggtcgattcgaatcggtc
accgaatgtgacgatccggcggccaaggcagctggcgaggaagcgaccaaaagctccgac
atcttcttcaagctggattgccacatcggcaaagagacaaaccatctgcatgatggaata
ctggccggactcgaggagaaaattgaaaagcgatcacctacgttggaccgcgacgctgtc
tacactaaacgatcccgcattgcccggctacccaagtatctgactgtgcactttgtccgc
tttttctggaagcgtgagacccaaaagaaggccaagatcatgcgcaaagtgactttccct
gccgaattggatgtggtggagttttgtacggaggagctcaagaagcagttgatccccatc
agggataaggtacgagatattcggaaagaagaggtcgacgttgagcgtgcccgcaagcgc
cagaagcttgctcatcaacgggaggaggagctgaagagagccgctgagtctgatgcgggt
ctggaacccctgcaaaagaagaaagctacggaggggcaaaaagaggctacaaagagcggc
gagcaagatggggacacagccatgacagatgtcttcaagtcagacgcagagtacgaggcc
gagaagtatgcctcaatactcgctgcaaagaaggaattggctgcactgattgaccccaaa
ctcgcctcagatgctggtacaaacaactcgggcctctacgagttgcgcgcagtcattacg
catcaaggcgccagtgctgacagtggacactacacgtcatatgtgaagaagcagccaaat
ggcaagggggtggaggacggaaaatggtggtggttcaacgacgagaaggtcaccgaagtg
gacggagagaagatcgaaacccttgctggtggtggcgaatcccattctgcactgatcctt
ctctaccgcgcagttgacttgcccactgcggaataa

DBGET integrated database retrieval system