KEGG   Aspergillus fumigatus: AFUA_6G02380Help
Entry
AFUA_6G02380      CDS       T01017                                 

Definition
ubiquitin C-terminal hydrolase (EC:3.1.2.15)
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
afm  Aspergillus fumigatus
Brite
Enzymes [BR:afm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     AFUA_6G02380
Peptidases [BR:afm01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   AFUA_6G02380
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 571 aa AA seqDB search
MFSVIVKHQGKRHEVELDPSANGETLKYQMYSLTGVEPERQKILVKGGQLKDETPLSALN
AKPGQTFMMMGTPSGGQDAVDLGRPKEPVKFLEDMTEAEAARAEGAIPAGLQNLGNTCYL
NSTLQTLRSVPELQQELLNYKPSAGSSAGSRLSDLSSLGLGGLGASMDLVSSLRDLFKQM
SETQEGFPPLMFLNALRSVFPQFAQKDRNGHGYAQQDAEEAWSQIVTQLRSKLVIKEGEG
DSATEVSFVDKFLAGRFESVTECDDPAAKAAGEEATKSSDIFFKLDCHIGKETNHLHDGI
LAGLEEKIEKRSPTLDRDAVYTKRSRIARLPKYLTVHFVRFFWKRETQKKAKIMRKVTFP
AELDVVEFCTEELKKQLIPIRDKVRDIRKEEVDVERARKRQKLAHQREEELKRAAESDAG
LEPLQKKKATEGQKEATKSGEQDGDTAMTDVFKSDAEYEAEKYASILAAKKELAALIDPK
LASDAGTNNSGLYELRAVITHQGASADSGHYTSYVKKQPNGKGVEDGKWWWFNDEKVTEV
DGEKIETLAGGGESHSALILLYRAVDLPTAE
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgttctcagttatcgtgaagcatcaaggcaaacgtcatgaagtcgagctcgatccgtct
gcaaatggcgaaacgctgaaatatcaaatgtactccttgactggagttgaacccgagaga
cagaagatcttggtcaagggtggccagctgaaagatgagacgcctttgtccgccctcaac
gctaaaccaggtcagacatttatgatgatgggtacaccgtctggcggccaagatgcggta
gacttgggacggccaaaggaaccagtcaagtttcttgaggatatgaccgaagccgaggcg
gccagagcggagggtgccattcctgctggtctacagaatcttggaaatacttgctacctc
aactctaccctacaaaccctgaggagcgtcccggagcttcaacaggagctcctaaattac
aagcccagcgcgggctcttcagcgggttcaagactttcagatctcagcagcctgggcctt
ggtggtcttggtgcctccatggatcttgtatcctccttgcgcgatttgttcaagcagatg
tccgagacgcaagaagggttcccaccacttatgtttctcaatgctttgagaagcgttttc
cctcaatttgctcagaaagacaggaatggtcatggctatgctcaacaagacgctgaagag
gcttggtcgcaaattgtcactcaactgcgaagcaaactggtgatcaaagagggcgaagga
gattccgctaccgaggtgtcgtttgtggataaatttcttgctggtcgattcgaatcggtc
accgaatgtgacgatccggcggccaaggcagctggcgaggaagcgaccaaaagctccgac
atcttcttcaagctggattgccacatcggcaaagagacaaaccatctgcatgatggaata
ctggccggactcgaggagaaaattgaaaagcgatcacctacgttggaccgcgacgctgtc
tacactaaacgatcccgcattgcccggctacccaagtatctgactgtgcactttgtccgc
tttttctggaagcgtgagacccaaaagaaggccaagatcatgcgcaaagtgactttccct
gccgaattggatgtggtggagttttgtacggaggagctcaagaagcagttgatccccatc
agggataaggtacgagatattcggaaagaagaggtcgacgttgagcgtgcccgcaagcgc
cagaagcttgctcatcaacgggaggaggagctgaagagagccgctgagtctgatgcgggt
ctggaacccctgcaaaagaagaaagctacggaggggcaaaaagaggctacaaagagcggc
gagcaagatggggacacagccatgacagatgtcttcaagtcagacgcagagtacgaggcc
gagaagtatgcctcaatactcgctgcaaagaaggaattggctgcactgattgaccccaaa
ctcgcctcagatgctggtacaaacaactcgggcctctacgagttgcgcgcagtcattacg
catcaaggcgccagtgctgacagtggacactacacgtcatatgtgaagaagcagccaaat
ggcaagggggtggaggacggaaaatggtggtggttcaacgacgagaaggtcaccgaagtg
gacggagagaagatcgaaacccttgctggtggtggcgaatcccattctgcactgatcctt
ctctaccgcgcagttgacttgcccactgcggaataa

DBGET integrated database retrieval system