KEGG   Aspergillus fumigatus: AFUA_6G02860Help
Entry
AFUA_6G02860      CDS       T01017                                 

Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
afm  Aspergillus fumigatus
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AFUA_6G02860
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AFUA_6G02860
Enzymes [BR:afm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     AFUA_6G02860
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 649 aa AA seqDB search
MFRSVPRRIPRRLPTLSSTAGSPSHLALRSFTCGYPRMSSSPLPTVEPPVSTTLPSDSFQ
LLSTAEKSGSAEDALYEQQIKDVEAWWKSPRFEGIKRPYSAADVVSKRGTLQQTYPSSLM
ARKLFNLLNERAAEGKPVHTMGAIDPVQMTQQAPNQEVLYISGWACSSLLTTTNEVSPDF
GDYPYNTVPNQVQRLFKAQQMHDRKQWDARRKMTPEQRKSTPYVDYMRPIVADGDTGHGG
LSAVLKLAKLFAENGAAAVHFEDQLHGGKKCGHLAGKVLVPIGEHINRLVAARFQWDMMG
VENLVIARTDSESGKLISSAIDVRDHEFILGVAEEVEPLAETLQAMEREGAAPAEIDAFE
LDWVKKHKLVTFDEAVDAHLEAEGAPQSVRDAYKKKVQENPDLSISRRRALASDYTKKPV
VWSCDSPRTREGFYHYRAGFPAATKRAKEFAPYADLLWVETGDPNVEKAGKLASDVRAAY
PGKKLVYNLSPSFNWMGQGFDEASLKSFVWDLAKHGFVLQLISLAGLHSNATITTELSRA
FKDEGMLAYVRLIQSREKELGVEVLTHQKWSGAPYMDGILGAIQSGSSSSKSMGEGNTEK
GKLSIHFDLLAINANNPKLQASKQIPRHGRIIIMPSVLLDRCRDKKKSP
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgctcagttcctcgtcggattcctcgacgtctccctactctctcttcgactgcc
ggcagtccatctcatctcgccttgcgttcattcacatgcggttacccgcggatgtcatca
tctccgctgccgaccgttgagcccccggtttcgacgaccttgccatcagactcatttcag
ttgctgtcaacagctgagaagtccgggagtgcggaggatgcactttatgagcaacaaatc
aaagatgtggaggcatggtggaaatccccgcggttcgagggtatcaagagaccctactcg
gccgcggacgttgtcagcaaacgtggcactttgcagcagacatatccgagctctttaatg
gctcgcaagctattcaatctgctaaatgagagagcggcagagggaaagccggttcatacc
atgggcgcaatcgatccagtacaaatgacacagcaagctccaaaccaggaggtgctgtat
atctcaggatgggcgtgctcctccctgttgactacaacgaatgaggtttctccggacttt
ggcgactacccttacaataccgttcccaatcaggtacagagattgttcaaggcgcaacag
atgcatgatcgcaagcaatgggatgccagaagaaaaatgaccccggaacagcgaaagtcg
accccttatgttgactacatgagaccgattgttgcggatggcgataccggacatggcggt
ctttccgcggtcctcaaattggccaagctttttgcggagaacggtgctgcagctgttcac
ttcgaagatcagctgcatggcggcaagaagtgcggtcatctcgcagggaaagtccttgtg
cctattggagaacacatcaacagactggtcgccgctcgtttccaatgggacatgatgggg
gtcgagaatctggtgattgctcgaacagattccgagagtggaaagttgattagcagcgcc
attgatgtacgtgatcacgagttcatcctcggtgttgcggaggaggtcgagcctttagcc
gagaccctacaagcaatggagcgcgaaggtgctgctcctgcagagatcgatgcatttgag
ctggactgggtcaagaagcacaagcttgtcactttcgatgaagctgtcgacgcacatctt
gaagccgaaggagcgccccagtcggtccgtgacgcatacaagaagaaggtccaagagaac
cctgacctgtctatctcgcgtcgccgagctctggcgagcgactacacaaagaaacccgtt
gtctggtcttgcgacagtcccaggaccagggaggggttctaccactaccgtgccggcttt
ccggcagcgacaaagcgagccaaggaatttgccccttacgcggacctcttgtgggttgaa
actggcgaccccaatgtcgagaaggctggaaaactagcaagcgatgttcgcgccgcatac
cccgggaagaaattggtctataaccttagcccgtcattcaactggatgggtcagggcttt
gacgaggcgtctctcaagtcttttgtctgggatctcgccaagcatggctttgtcctccaa
cttatctcccttgccggtctgcacagcaacgccacgatcacgaccgagctttcacgcgcc
ttcaaggatgagggaatgctcgcttacgtgcgactgatccagtcccgcgagaaggaactc
ggggtcgaggtcctcacccaccagaaatggagcggtgcaccatacatggacggcatctta
ggcgccatccagagcggcagtagcagcagcaagagcatgggagagggaaacactgagaag
ggtaagctgtctatccacttcgacttgctagcaataaatgctaacaatccaaaattacag
gcttctaagcaaatcccccgtcatggccggattataataatgccaagcgtcttgcttgac
aggtgtagagataaaaaaaaatccccatag

  All links  
No link information was found.   
DBGET integrated database retrieval system