KEGG   Aspergillus fumigatus: AFUA_6G03540Help
Entry
AFUA_6G03540      CDS       T01017                                 

Definition
malate synthase AcuE (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
afm  Aspergillus fumigatus
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AFUA_6G03540
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AFUA_6G03540
   00630 Glyoxylate and dicarboxylate metabolism
    AFUA_6G03540
Enzymes [BR:afm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     AFUA_6G03540
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 539 aa AA seqDB search
MSQIEVQLKDVAILGAVNNEHRKILTKEACAFLAILHRTFNPTRKALLQRRIDRQAEIDK
GHLPDFLPETKHIRENDAWKGAPPAPGLVDRRVEITGPTDRKMVVNALNADVWTYMADFE
DSSAPTWANMINGQVNLYDAIRRQIDFKQGNKEYKLRTDRALPTLIARARGWHLDEKHFT
VDGEPISGSLFDFGLYFFHNAKELVARGHGPYFYLPKMESHLEARLWNDVFNLAQDYIGM
PRGTIRATVLIETITAAFEMDEIIYELRDHSSGLNCGRWDYIFSFIKKFRKHPNFVLPDR
SDVTMTVPFMDAYVKLLIKTCHRRGVHAMGGMAAQIPIKDDPVANDKAMESVRADKLREV
RAGHDGTWVAHPALASIASEVFNKYMPTPNQLFVRRQDVNITANDLLNTNVPGKITEEGI
RKNLNIGLSYMEGWLRGVGCIPINYLMEDAATAEVSRSQLWQWVHHQVTSSEGKKIDKAY
ALRLLQEQADSLAAKSPKGNKFQLAARYFAGQVTGEDYADFLTSLLYNEISTPGTASKL
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaatcgaagtacagctcaaggatgtcgccatcctgggcgccgtgaacaacgag
catcgcaagatcctcaccaaggaagcttgcgctttcctcgccatcctccaccgcaccttc
aaccctacccggaaagccctcctgcagcgccgtatcgatcgccaggccgagatcgacaag
ggtcatctgcctgacttcctccccgagaccaaacacattcgtgaaaatgacgcctggaag
ggtgctcctcccgctcccggtctggttgaccgtcgcgtggagatcactggtcccacggac
cgcaagatggtcgtcaatgctctgaatgcggacgtctggacttacatggcggatttcgag
gactcgagtgcccctacctgggcgaacatgatcaacggtcaagtcaacttgtacgatgct
attcgccgtcagatcgacttcaagcaaggaaacaaggagtacaagctccgtacagaccgc
gcccttcccaccctgattgctcgtgctcgaggctggcaccttgacgagaagcactttact
gtggacggcgagcctatctctggcagcttgttcgactttggtctttacttcttccacaac
gccaaggagctggttgctcgcggccacggtccttacttctacctccccaagatggagtcc
cacctcgaggccagactctggaatgacgtcttcaacctcgctcaggactacatcggcatg
ccccgggggaccatccgtgcgactgttctgattgagaccatcactgctgcgtttgagatg
gatgagattatctatgaactgcgtgatcacagctccggtctcaactgcggccgctgggat
tacatcttctccttcatcaagaagttccgcaagcaccccaactttgtccttcccgaccgc
tctgatgtcaccatgactgtgccattcatggacgcctatgtgaagctgctcatcaagact
tgccaccgccgtggtgttcacgctatgggtggtatggctgctcagatccctatcaaggat
gaccctgtcgccaacgacaaggccatggagagcgtgcgcgccgacaagctgcgtgaggtc
cgtgccggccacgacggtacctgggttgctcaccccgctctcgcctccattgcctccgag
gtcttcaacaaatacatgcctacccccaaccagctgttcgtccgccggcaggacgtcaac
atcaccgccaacgatctgctcaacaccaacgtccctggcaagatcaccgaagagggtatc
cgcaagaatttgaacatcggtctttcctacatggagggctggctccgcggtgtcggctgc
atcccgatcaactacctgatggaggatgccgctaccgccgaagtgtcccggtctcagctc
tggcagtgggtgcaccaccaggtcaccagctccgagggcaagaagatcgacaaggcctac
gctctgcgtctgctccaggagcaggccgacagcctggccgccaagtcacccaagggcaac
aagttccagctggcggcccgttactttgccggtcaggtgacgggtgaggactatgcggac
ttccttaccagtctgctgtacaatgagatctcgaccccgggtactgcgtcgaaattgtag

DBGET integrated database retrieval system