KEGG   Aspergillus fumigatus: AFUA_6G04540Help
Entry
AFUA_6G04540      CDS       T01017                                 

Definition
calcineurin Ca2+-binding regulatory subunit CnaB
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
afm  Aspergillus fumigatus
Brite
Protein phosphatases and associated proteins [BR:afm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     AFUA_6G04540
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 193 aa AA seqDB search
MEQPSEPNNAAMYDARRRRASVGTSQLLDNIVSASNFDRDEVDRLRKRFMKLDKDSSGTI
DRDEFLSLPQVSSNPLATRMIAIFDEDGGGDVDFQEFVSGLSAFSSKGNKEEKLRFAFKV
YDIDRDGYISNGELFIVLKMMVGNNLKDVQLQQIVDKTIMEADKDRDGKISFEEFTEMVE
NTDVSLSMTLSMF
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggagcagcccagtgaaccaaataatgccgctatgtatgatgcacgcaggcgtagagca
tctgttgggacatcacagttattagacaacattgtctcggcttcgaatttcgacagagat
gaggtggacaggctccgcaagcgcttcatgaaacttgacaaggatagctccggcaccatc
gatcgtgacgagttcctttccctcccacaagtgtcctcaaacccgctcgcaacgaggatg
atcgcgatcttcgacgaagacggcggcggggatgttgacttccaggagtttgtgtcgggg
ctgtcggctttcagctccaagggtaacaaagaggagaagctccggttcgcgttcaaggtc
tacgacattgaccgggacggctatatctccaacggcgagctgttcatcgtgcttaagatg
atggtgggcaataacctgaaggacgtgcagctgcagcagatcgtggataagacgatcatg
gaagcggataaggaccgcgacggcaagatcagcttcgaggagttcacggagatggtggag
aataccgatgtcagcttgagcatgacactgagtatgttctag

  All links  
No link information was found.   
DBGET integrated database retrieval system