KEGG   Aspergillus fumigatus: AFUA_6G06760Help
Entry
AFUA_6G06760      CDS       T01017                                 

Definition
eukaryotic translation initiation factor 3 subunit EifCj
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
afm  Aspergillus fumigatus
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:afm00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    AFUA_6G06760
Translation factors [BR:afm03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    AFUA_6G06760
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 267 aa AA seqDB search
MAPSKWDDEEDSSPPPPPPVVARRKFDDEEEEDVLDSWDAAEDSEVEREKAAKAAAAAAK
AEAEAAAKKKSKAQRIEERKQERKKLAEANESDEDSEEDEAARRARLRRTEKEGDLKHAQ
DLFEDIDLNRNRGTPKAIVISDSADPTQAVDLSAMPLFKPTTKDQFTRLTSTLIPLLTAH
SKKPHYALWAQEFTKQLVKELNSGDVKKIASALTTISNEKMREERAADKGNKKTKAAKTK
VSLVASRDNKIDATPYDDDGLDDDDFM
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggcgccttcaaagtgggatgatgaggaagacagcagcccgcccccgcccccgccggtg
gtggccagacgcaagttcgacgatgaggaggaggaagatgtccttgactcgtgggacgcc
gccgaagactcagaagtagagcgggaaaaggccgcaaaggctgcagcggcggcagccaag
gccgaagccgaggcggccgcgaagaagaagagcaaggcacagcggatagaggagcgcaag
caggagcgaaagaaactggccgaggcgaacgagagcgacgaggacagcgaagaggacgag
gcggcgaggcgggcccgtctgcgccgcacggagaaggagggtgacctcaagcacgcgcag
gacctgttcgaggacatcgacctgaaccgtaaccgtggcacccccaaggcgattgtcatc
agcgactcggccgatcccacgcaggccgtcgacctctccgccatgccactgttcaagcct
acaaccaaggaccagttcacccggctgaccagcacgctgatccccctgctgacggcgcac
tcgaagaaacctcactatgccctgtgggcgcaggagttcaccaagcagcttgtcaaggag
cttaacagcggtgatgtcaagaagattgccagtgccctcaccactatcagcaacgagaag
atgagagaggagcgtgccgccgacaaaggcaacaagaagaccaaggctgccaagaccaag
gtttctctcgttgctagcagagacaacaagattgatgccacaccttatgatgatgatgga
ctggacgatgacgacttcatgtga

DBGET integrated database retrieval system