KEGG   Aspergillus fumigatus: AFUA_6G06760Help
Entry
AFUA_6G06760      CDS       T01017                                 

Definition
eukaryotic translation initiation factor 3 subunit EifCj
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
afm  Aspergillus fumigatus
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:afm03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 267 aa AA seqDB search
MAPSKWDDEEDSSPPPPPPVVARRKFDDEEEEDVLDSWDAAEDSEVEREKAAKAAAAAAK
AEAEAAAKKKSKAQRIEERKQERKKLAEANESDEDSEEDEAARRARLRRTEKEGDLKHAQ
DLFEDIDLNRNRGTPKAIVISDSADPTQAVDLSAMPLFKPTTKDQFTRLTSTLIPLLTAH
SKKPHYALWAQEFTKQLVKELNSGDVKKIASALTTISNEKMREERAADKGNKKTKAAKTK
VSLVASRDNKIDATPYDDDGLDDDDFM
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggcgccttcaaagtgggatgatgaggaagacagcagcccgcccccgcccccgccggtg
gtggccagacgcaagttcgacgatgaggaggaggaagatgtccttgactcgtgggacgcc
gccgaagactcagaagtagagcgggaaaaggccgcaaaggctgcagcggcggcagccaag
gccgaagccgaggcggccgcgaagaagaagagcaaggcacagcggatagaggagcgcaag
caggagcgaaagaaactggccgaggcgaacgagagcgacgaggacagcgaagaggacgag
gcggcgaggcgggcccgtctgcgccgcacggagaaggagggtgacctcaagcacgcgcag
gacctgttcgaggacatcgacctgaaccgtaaccgtggcacccccaaggcgattgtcatc
agcgactcggccgatcccacgcaggccgtcgacctctccgccatgccactgttcaagcct
acaaccaaggaccagttcacccggctgaccagcacgctgatccccctgctgacggcgcac
tcgaagaaacctcactatgccctgtgggcgcaggagttcaccaagcagcttgtcaaggag
cttaacagcggtgatgtcaagaagattgccagtgccctcaccactatcagcaacgagaag
atgagagaggagcgtgccgccgacaaaggcaacaagaagaccaaggctgccaagaccaag
gtttctctcgttgctagcagagacaacaagattgatgccacaccttatgatgatgatgga
ctggacgatgacgacttcatgtga

DBGET integrated database retrieval system