KEGG   Aspergillus fumigatus: AFUA_6G07480Help
Entry
AFUA_6G07480      CDS       T01017                                 

Definition
endoglucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
afm  Aspergillus fumigatus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:afm00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 306 aa AA seqDB search
MKFGSIVLIAAAAGFAVAAPAKRASGKEFIFPDPSTISTLIGKGMNIFRIQFLMERLVPS
SMTGSYNEEYLANLTSVVDAVTKAGSYAILDPHNFGRYNGQIISSTDDFKTFWQNLAGKF
KSNNLVIFDTNNEYHDMDQTLVLNLNQAAINGIRAAGATSQYIFVEGNSWTGAWTWADVN
DNLKALTDPHDKIVYEMHQYLDSDGSGTAESCVSTTIGKERVSAATKWLKDNGKVGIIGE
FAGGVNDQCRTAISGMLEYLAQNTDVWKGALWWAAGPWWGNYMFNMEPPSGAAYVGMLDI
LEPYLG
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcggtagcattgtgctcattgctgctgcggcaggcttcgcggtggctgctcct
gcaaagagagcttcggggaaagaattcatcttcccggacccttctacaatcagcacattg
atcgggaagggcatgaacatcttccggattcaattcctcatggagagactggtgccaagc
tctatgacaggctcctataatgaggagtaccttgccaatctgacatcggttgtggacgct
gtcaccaaggcaggatcttatgctattttggacccacacaactttggcagatacaatggt
cagattatctccagcaccgacgacttcaagaccttctggcagaatctggctggaaagttc
aagtccaacaatctcgtcatctttgatactaacaatgagtatcacgacatggaccagaca
ctggtactgaacctcaaccaggccgctatcaacggtatccgcgctgcaggagccacctcg
caatacatctttgtggagggcaactcctggaccggcgcctggacctgggccgacgtcaat
gacaacctgaaggctctgaccgacccccatgataagatcgtctacgagatgcaccagtat
ctcgactcggatggatccggcaccgcggagagctgcgtgtctaccacgattggtaaggag
cgggtttctgccgcaacaaagtggctcaaggataacggcaaggttggcatcattggtgag
ttcgctggtggcgtcaatgatcagtgccggaccgctatttcaggaatgctggagtacttg
gctcagaacacagacgtgtggaagggagctctctggtgggcggctggcccctggtgggga
aactatatgttcaacatggagcctccgagcggtgcagcttatgtgggcatgttggacatc
ttggagccctacctgggttga

DBGET integrated database retrieval system