KEGG   Aspergillus fumigatus: AFUA_6G07940Help
Entry
AFUA_6G07940      CDS       T01017                                 

Definition
lactoylglutathione lyase (EC:4.4.1.5)
Orthology
K01759  
lactoylglutathione lyase [EC:4.4.1.5]
Organism
afm  Aspergillus fumigatus
Pathway
Pyruvate metabolism
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AFUA_6G07940
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    AFUA_6G07940
Enzymes [BR:afm01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.5  lactoylglutathione lyase
     AFUA_6G07940
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 318 aa AA seqDB search
MATDTIKYKLNHTMIRVKDPKRSVEFYKFLGLNQIQQLDFPENKFSLYFLAYNGPQSLQG
DRHWTDRNAVLELTHNYGTENDPNYTVANGNTEPHRGFGHIAISVDNIEAACKRLEDAGY
QFQKKLTEGRMKHIAFVKDPDGYWVEIIRRHDQDVGTATDPGTYRLNHTMLRVKSAETSL
KFYQEVMGMTLVRTIENKDAAFNLYFLGYPASNPTAQEGAKNPVAEWEGLLELTWNYGTE
KQEGKVYHDGNSEPQGFGHICVSVDDLNAACDRFESLNVNWKKRLTDGRMKNVAFILDPD
GYWIEVIQNEALKRTSNW
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggcgacagacaccatcaagtataagcttaatcacactatgatccgggtcaaagaccct
aagagatcagtggagttctacaagttccttgggctcaatcagatccagcagctcgacttt
cctgagaacaagttctccctctacttcctcgcctacaatggcccccagtcgctgcagggc
gaccgtcactggacggaccgcaatgcagtgctggaactcacgcacaactatggcacggag
aatgaccccaattacactgttgccaatgggaatacggagccccatcgcggtttcgggcac
attgccatctcggtcgacaacatcgaagcggcctgcaagagactcgaagacgctgggtat
caattccagaaaaagctcaccgagggtcgcatgaagcacattgcgtttgtaaaggatccc
gatggatactgggttgagatcatccgccgccacgaccaggatgtggggactgcgacggat
ccaggcacctaccgactgaaccacaccatgttacgggtcaagtccgctgagaccagtctc
aagttctaccaggaggttatgggcatgacccttgttcgcactatcgagaacaaggatgct
gccttcaacctctacttcctgggataccctgcgtctaaccccactgcccaggaaggtgcg
aagaatcctgtggctgaatgggaggggctgctcgagcttacctggaactacggtacggag
aagcaagaaggcaaggtgtaccatgatggtaattcggagcctcaagggttcggtcatatt
tgtgtctctgttgacgatctcaatgctgcctgcgatcggttcgagtcgctcaacgtgaac
tggaagaagcgtctgacagacgggcggatgaagaatgtggctttcattcttgacccggat
ggctattggatcgaggtgatccagaacgaggcgttgaaacgtaccagcaattggtaa

DBGET integrated database retrieval system