KEGG   Aspergillus fumigatus: AFUA_6G08440Help
Entry
AFUA_6G08440      CDS       T01017                                 

Definition
(RefSeq) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
afm  Aspergillus fumigatus
Pathway
afm00860  Porphyrin and chlorophyll metabolism
afm01100  Metabolic pathways
afm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AFUA_6G08440
Enzymes [BR:afm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     AFUA_6G08440
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     AFUA_6G08440
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Pyr_redox_2 NAD_binding_9 MCRA
Motif
Other DBs
NCBI-GeneID: 3508834
NCBI-ProteinID: XP_750733
UniProt: Q4WMW9
Position
6
AA seq 603 aa AA seqDB search
MRLPCAPSLALRAARTPLAFARNGQKHSLHTGTYNAAVIGGGITGLATAFRLSQDPKCTH
ITLYEKQQRVGGWMMSETIPLGDDDGKVVFEYGPRTLRAAAPTCLPLLDLLVELELLEDV
LITTKSSPAAQNRYIYYPDHLVRMPGRDPGRSLFSELYSNFRTLLTEPVFDKLVRSVVTE
PARLPPGPKSVDSDESVRDFISRRLAPEIADNIVSAVYHGIYAGDIDRLSAQTLLGTYRD
LEHDDRRVIGGLVHAATSDITYNLMDDWLALHSLAATKQKSYWSSLKTLVRDASVITFKN
GVQQLTDALAAALRKSRKVDLLTGTEVMAISTNPANSDLTIHFGEGKSNTHNRVIATNPP
PNLAQQLAKPTRSGQRLPQNSIRQLQEHNYAVTVMVVNILYENPNLLPVKGFGYLIPQSV
PFEHNPEMALGVIFGSESSVGQDTVPCTKLTVMLGGHYWDGWKTSDYPDPDTAIGMCQTL
LHRHLGITEKPLQAAVKLQRQAIPQYTVGHLSRMRDLSQTVRQDFNNRLTLAGNWYNGVG
VTDCVQQAYMAASYGVGALKLDAPSVNVPWIRYNWQGWELEGGIPTSPVRITETYRSERN
YFF
NT seq 1812 nt NT seq  +upstreamnt  +downstreamnt
atgcgactgccatgtgcccctagccttgcactgagggcagcgcggacgccattggcgttc
gcccgcaatggccagaagcactcactgcataccggcacctacaacgccgctgttatagga
ggtggcatcacaggtcttgcgacggccttccgcttgtcgcaggacccaaaatgcacccat
atcaccctgtacgagaaacaacagcgagtcgggggctggatgatgtcggaaaccattcct
ctcggcgacgatgatgggaaagttgtattcgaatatgggccaaggaccctgcgggctgcg
gctcccacttgtctcccacttcttgacttgctggtcgagctcgaattactcgaggatgtg
ttgatcacgaccaagtcgtcccccgcagcccaaaatcgctacatctactaccccgatcac
cttgttcgcatgcctggtcgcgatcccggccgtagcctgttctcagagctttactcgaac
tttcggacattgcttacggaacccgtctttgacaaactcgtgcgaagtgttgtgacggag
ccagcgaggttgcccccggggcccaagtcagttgactccgacgagtctgtgagggacttt
atttctcggcgacttgcccccgagatcgcagataacatagtctcggccgtgtatcatggt
atctacgccggcgacattgaccgcctgagtgcgcagaccctgctgggaacctaccgggac
cttgagcatgatgaccgccgcgtaattgggggccttgtacatgcagccacctcagatatc
acgtacaatctgatggatgattggctggcgctgcattcgctggctgcgacaaagcagaag
agctattggagtagtctgaagacgctggtcagagacgccagtgttatcaccttcaaaaac
ggcgtgcagcagcttactgatgccttggctgcggcattgcgcaaatccaggaaagtggac
ttgctgactggtacagaggtgatggctatcagtacaaatcctgccaattccgatctgacc
atccacttcggagaggggaagtcgaatacccataaccgcgtaattgcaacgaacccgccg
cccaacctggcacagcagttggccaagcctacaaggtcgggacagaggctgcctcaaaac
tcgattcgccaactgcaagaacacaactacgccgtgactgtgatggttgtcaacatcctg
tatgagaatcccaatctcctccccgtcaagggattcggctacttgatcccacagtctgtt
ccgttcgaacacaatcccgagatggctctaggggtgatcttcggttccgagtctagtgta
ggtcaggacactgtgccctgcaccaagctcaccgtcatgctgggcgggcactattgggat
ggctggaagacatcagactacccagacccggataccgccattgggatgtgccaaaccctg
ctccatagacatcttggcatcaccgagaagcctcttcaggctgctgtcaaactgcaacgt
caagctattccccagtacacggtcggccatctctcgcgcatgcgggacctttcacaaaca
gtgcgccaggatttcaataaccggctgactctggctggaaattggtacaatggcgtcggg
gtgacggattgcgttcagcaggcgtacatggctgcctcgtacggcgttggtgcacttaag
ctcgatgcaccgagcgttaatgttccctggattaggtacaactggcagggatgggaatta
gaggggggtataccaacctctcctgtgcgaataacagagacttacaggtcggaacgcaat
tatttcttctaa

DBGET integrated database retrieval system