KEGG   Aspergillus fumigatus: AFUA_6G10460Help
Entry
AFUA_6G10460      CDS       T01017                                 

Definition
ceramide synthase membrane component (LAG1)
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
afm  Aspergillus fumigatus
Pathway
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    AFUA_6G10460
Enzymes [BR:afm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     AFUA_6G10460
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 440 aa AA seqDB search
MGRSRKSSHLGDIPGDTTAPAMSTMNEVSPVEEDAPKWDKALQNQVTPEKALKSQTRRRK
NRSPLRRFKDLCLKHTWVLPLLLMSVILLAYAVNPTPANPFHSAIFLSYPQPPKTPGGPV
MYGKGPLDFAFVGFYTIVLSFTREFLMQCVIRPWAGYCGIRGRGKTARFMEQVYTAMYFA
IFGPFGLYVMKQTDIWYFNTTAMFEGFPHREHVAIFKAYYLLQASYWAQQAIVLLLQLEK
PRKDFKELVGHHIITLALIGLSYRFHFTYMGIAVYITHDISDFFLATSKILNYLDSIITV
PYFGTFVLMWIYLRHFLNLKILWAVLTEFRTVGPYELNWETQQYKCWISQIITFVLLASL
QAVNLFWLFLILRILKNYIFNSVKKDERSDDETEEELEHEAESRATLATGAEQPLLTTRN
TNKAPQVFVNGEPYGAKTHS
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgctcgcgcaaatccagccatctgggcgatattccaggcgataccaccgctcct
gccatgtcgaccatgaacgaggtcagccctgttgaggaagatgctccaaaatgggacaag
gccttgcagaaccaggtaacccctgaaaaggctctcaaatcgcagaccaggcggcgtaag
aaccgatcgcccctccgtcggttcaaggacttatgtttaaaacacacctgggttctgcct
ctcctgctgatgagcgtaatcctcctcgcatacgccgttaatcctacgccggccaatcct
ttccacagcgctatcttcttgtcttacccgcaacctcccaagactcccggcggtccggtt
atgtacggcaaaggtcccttggactttgcttttgtcggcttctacaccattgtcctgtct
ttcacacgagagtttctgatgcaatgcgtgattcgcccatgggctggatactgtggcatt
cggggcagaggcaagactgctagattcatggagcaggtctacacagccatgtactttgcg
atctttggacctttcggtctgtatgtgatgaaacagacggatatctggtacttcaacacc
acggccatgtttgagggtttccctcaccgggagcacgtcgccatcttcaaggcctattac
ctgctccaggctagttactgggctcagcaagcgattgtattgctgttacaactcgaaaag
ccccgaaaggatttcaaggaacttgtcggtcatcacatcatcactttggcgctgatcggg
ttgagttaccggttccacttcacctatatgggcattgcggtctatatcacccacgacatc
tcagatttcttcctagcgacctcaaaaatcctcaactacctggactccatcatcactgta
ccatactttggcaccttcgtccttatgtggatctacctccgccatttcctcaacctgaag
atcctctgggccgtgctgaccgaattccgcaccgttggcccctacgagctcaactgggag
acccagcaatacaaatgctggatcagtcagatcatcacctttgtcctgctggccagtctg
caagcagtcaatctcttctggctcttcttgatcctccgcattctcaagaactacatcttc
aacagcgtgaagaaggacgaaagaagcgacgacgagaccgaagaggaacttgaacatgag
gcagagagccgtgccacccttgccactggagcggagcaacctcttctcaccactcgcaat
acaaacaaggcccctcaggtctttgtcaacggcgaaccttatggcgcaaaaactcactct
tag

DBGET integrated database retrieval system