KEGG   Aspergillus fumigatus: AFUA_6G10560Help
Entry
AFUA_6G10560      CDS       T01017                                 

Definition
DNA polymerase delta subunit 4
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
afm  Aspergillus fumigatus
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    AFUA_6G10560
   00240 Pyrimidine metabolism
    AFUA_6G10560
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    AFUA_6G10560
   03410 Base excision repair
    AFUA_6G10560
   03420 Nucleotide excision repair
    AFUA_6G10560
   03430 Mismatch repair
    AFUA_6G10560
   03440 Homologous recombination
    AFUA_6G10560
DNA repair and recombination proteins [BR:afm03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      AFUA_6G10560
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 193 aa AA seqDB search
MPTTRRRRGNTAASRSGQSTLSFGGKSRVTKPSATSTQSQKTKHLEPISAAVSSTEEVPD
PDQVPVAPSEPSQPHVAELAVRQQAQEEIQQPLSEEDQKAIRITEQELQRYWKKEEQTRK
APRVHQEDLSLHEKILRHFDLSSQYGPCIGIARLKRWRRAKMLDLNPPIEVLAVLLKEKD
TVKQRAYVDELLS
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgcccaccactcgtcgccgtagaggcaacactgccgcctcccgctcaggtcagtcgacg
ctttcattcggtggaaagtccagagtcaccaagccatcggccacatcgacacaatctcag
aagaccaaacacctcgaaccaatctcagctgctgtttcctcgaccgaagaggtcccagac
ccggatcaagtgccagtcgctccctcggagccgtcacagccgcacgttgcggagctcgct
gtcagacagcaagcccaggaggagatccagcaaccgctgagcgaggaggatcagaaggcg
atcaggatcacagaacaggaactgcagcggtattggaagaaggaggagcagacaaggaag
gcacctcgagtccaccaggaagatctatcattacacgagaaaatactgagacattttgat
ctgtctagtcagtatgggccatgcatcggaattgctcggctaaagcgctggagacgtgcg
aagatgctggacctcaatcctcctatcgaagtcctggctgtcttgctgaaagagaaagac
acggtgaagcagagagcttatgtcgatgagttgctgtcttga

DBGET integrated database retrieval system