KEGG   Aspergillus fumigatus: AFUA_6G11130Help
Entry
AFUA_6G11130      CDS       T01017                                 

Definition
(RefSeq) possible replication factor-a protein
  KO
K10739  
replication factor A2
Organism
afm  Aspergillus fumigatus
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:afm00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    AFUA_6G11130
   03420 Nucleotide excision repair
    AFUA_6G11130
   03430 Mismatch repair
    AFUA_6G11130
   03440 Homologous recombination
    AFUA_6G11130
DNA replication proteins [BR:afm03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    AFUA_6G11130
DNA repair and recombination proteins [BR:afm03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     AFUA_6G11130
   MMR (mismatch exicision repair)
     AFUA_6G11130
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     AFUA_6G11130
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
6
AA seq 289 aa AA seqDB search
MPRDASNTSRRDGGYTNYGNTSYGGGGGGGFMPGEMNSPAGGKGDNNNATLRPITVKQAL
DASQPYPEAAFQIDGADAASVCFIGQVRNISSQSTNVTYKIDDGTGEIEVKQWIDTQTAD
TMETDDGKAGTGKNQVELNGFAKVFGKIKSFGNKRYVGAHCVRPTTNLNEVHCHLLEAAA
IHLFFTRGPPGGGAAGGASGAGANADAAMGGANDYGTGNSNLPAMSPAARRVYNLLKTEP
QSNEGLHAQLIAAKLNLPMPDVARAGEELLTAGVIFSTVDEQTWAILEY
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgccccgcgacgcgtccaacacgtcccgaagagacgggggttacactaattatgggaac
acctcatacggaggtggaggcggcggtggcttcatgcctggagaaatgaacagtccagcc
ggtggaaagggagacaacaacaacgccacccttcgtccgatcacagtcaaacaagcccta
gacgcctcacaaccataccccgaagccgccttccagattgacggagccgacgcggccagc
gtctgcttcattggtcaagtccgcaacatcagctcacagagcacaaacgtcacatacaag
attgatgatggcacaggggagattgaagtgaagcagtggatagacacacagaccgccgac
acgatggagacggatgatgggaaagccggcactgggaagaaccaagtcgagctaaacgga
ttcgcaaaggtgttcggaaagatcaagtccttcgggaataagcgatacgtgggagcgcac
tgtgtacggccaacgacgaacctcaacgaggtacactgccaccttctcgaggccgctgcg
atccatttgttttttacgcgtggtcctcctggtggtggagccgctggcggcgcttctggt
gctggggccaacgcggacgccgcaatgggcggtgcaaatgactacggtactggcaacagt
aatctccctgctatgagccctgccgctcggagagtctataacctcttgaagactgagcct
caaagcaacgagggtctacacgctcagttgatcgccgccaaattgaatctgccgatgccc
gatgtagcacgggctggagaggagttgcttactgctggtgttattttctcaactgtcgat
gaacagacttgggcgattctggagtactag

DBGET integrated database retrieval system