KEGG   Aspergillus fumigatus: AFUA_6G11130Help
Entry
AFUA_6G11130      CDS       T01017                                 

Definition
possible replication factor-a protein
Orthology
K10739  
replication factor A2
Organism
afm  Aspergillus fumigatus
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Class
Genetic Information Processing; Replication and repair; DNA replication [PATH:afm03030]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:afm03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:afm03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:afm03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 289 aa AA seqDB search
MPRDASNTSRRDGGYTNYGNTSYGGGGGGGFMPGEMNSPAGGKGDNNNATLRPITVKQAL
DASQPYPEAAFQIDGADAASVCFIGQVRNISSQSTNVTYKIDDGTGEIEVKQWIDTQTAD
TMETDDGKAGTGKNQVELNGFAKVFGKIKSFGNKRYVGAHCVRPTTNLNEVHCHLLEAAA
IHLFFTRGPPGGGAAGGASGAGANADAAMGGANDYGTGNSNLPAMSPAARRVYNLLKTEP
QSNEGLHAQLIAAKLNLPMPDVARAGEELLTAGVIFSTVDEQTWAILEY
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgccccgcgacgcgtccaacacgtcccgaagagacgggggttacactaattatgggaac
acctcatacggaggtggaggcggcggtggcttcatgcctggagaaatgaacagtccagcc
ggtggaaagggagacaacaacaacgccacccttcgtccgatcacagtcaaacaagcccta
gacgcctcacaaccataccccgaagccgccttccagattgacggagccgacgcggccagc
gtctgcttcattggtcaagtccgcaacatcagctcacagagcacaaacgtcacatacaag
attgatgatggcacaggggagattgaagtgaagcagtggatagacacacagaccgccgac
acgatggagacggatgatgggaaagccggcactgggaagaaccaagtcgagctaaacgga
ttcgcaaaggtgttcggaaagatcaagtccttcgggaataagcgatacgtgggagcgcac
tgtgtacggccaacgacgaacctcaacgaggtacactgccaccttctcgaggccgctgcg
atccatttgttttttacgcgtggtcctcctggtggtggagccgctggcggcgcttctggt
gctggggccaacgcggacgccgcaatgggcggtgcaaatgactacggtactggcaacagt
aatctccctgctatgagccctgccgctcggagagtctataacctcttgaagactgagcct
caaagcaacgagggtctacacgctcagttgatcgccgccaaattgaatctgccgatgccc
gatgtagcacgggctggagaggagttgcttactgctggtgttattttctcaactgtcgat
gaacagacttgggcgattctggagtactag

DBGET integrated database retrieval system