KEGG   Aspergillus fumigatus: AFUA_6G11310Help
Entry
AFUA_6G11310      CDS       T01017                                 

Definition
bifunctional pyrimidine biosynthesis protein (PyrABCN), putative (EC:6.3.5.5)
Orthology
K11541  
carbamoyl-phosphate synthase / aspartate carbamoyltransferase [EC:6.3.5.5 2.1.3.2]
Organism
afm  Aspergillus fumigatus
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:afm00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:afm00250]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 2253 aa AA seqDB search
MPQSAGNDEVALPSSPLSGGAVSYNQINKELQPLPSMDSGNGAVIPPASARVRGSSGKMF
ALELEDGTIYQGYSFGAEKSVAGELVFQTGMVGYPESITDPSYRGQILVITFPLVGNYGV
PSRETMDELLKTLPKYFESTEIHVAALVVATYAGEDYSHFLAESSLGQWLKEQGVPAMHG
VDTRALTKRIREKGSMLGRMMLSKSEIADGVVEMTPGDKDSWRSSFEQVEWVDPNKKNLV
SEVSIREPRLFTPPENVALKHPSGRPVRVLCLDVGMKFNQLRCLLARGVEVLVVPWDYDF
PKLAGKDYDGLFVSNGPGDPAMLSETVNNLSKTLKEARTPVFGICLGHQLIARSVGAQTL
KMKFGNRGHNIPCTSMLSGKCHITSQNHGYAVDSSTLPEGWEELFVNANDGSNEGIRHVS
RPFFSVQFHPESTPGPRDTEYLFDVFINTIKDTLTSSDALQKPVSFPGGTKAENIKTSPR
VSVKKVLILGSGGLSIGQAGEFDYSGSQAIKALKEEGIYTILINPNIATIQTSKGLADKV
YFLPVNAEFVRKVIKHERPDAIYVTFGGQTALQVGIQLKDEFESLGVKVLGTPIDTIITT
EDRELFARSMESINEKCAKSASASNLEEALRVVEDIGFPVIVRAAYALGGLGSGFADNLD
QLKELCTKAFAVSPQVLIEKSMKGWKEIEYEVVRDCQDNCITVCNMENFDPLGIHTGDSI
VVAPSQTLSDEDYNMLRTTAVNVIRHLGVVGECNIQYALNPFSKEYCIIEVNARLSRSSA
LASKATGYPLAFIAAKLGLGIPLNEIKNSVTKVTCACFEPSLDYCVVKIPRWDLKKFTRV
STQLGSSMKSVGEVMAIGRTFEEAIQKAIRSVDFHNLGFNETNALMSIDQELQTPSDQRL
FAIANAMAAGYSVDDIWKLTRIDKWFLARLKRLSDFGKLMSTYNATTVPRPLLREAKQLG
FSDRQLAKFLSSNELSIRRLRVEAGIIPIVKQIDTVAAEFPSVTNYLYLTYNASAHDVAF
DDNGILVLGSGVYRIGSSVEFDWCSVRTIRTLREQGLKTVMVNYNPETVSTDYDEADRLY
FENINLETVLDIYQLESSSGVVISMGGQTPNNIALPLHRLNVKILGTSPEMIDSAENRYK
FSRMLDRIGVDQPAWKELTSIEEAKGFCDKVGYPVLVRPSYVLSGAAMNTVYSEHDLATY
LNQAADVSREHPVVITKYIENAKEIEMDAVARNGVMVGHFISEHVENAGVHSGDATLILP
PQDLDPETVRRIEEATAKIGNALNVTGPFNIQFIAKDNDIKVIECNVRASRSFPFVSKVM
GVDLIEMATKAMIGKPFAEYPPVTIPKNYVGVKVPQFSFSRLSGADPVLGVEMASTGEVA
SFGRDKYEAYLKALISTGFRLPKKNVLFSIGSYKEKMEMLPSIKKLHQLGFNLFATSGTA
DFLKEHGVPVKYLEVLPGQEDDLKSEYSLTQHLANNLIDLYINLPSNNRFRRPANYMSKG
YRTRRMAVDYQTPLVTNVKNAKILIEAIARHFALNVQTIDYQTSHRTIILPGLINITAFV
PGLVTPGSNDFELVTKASIAAGFSMIRVMPVGVDASVTDARALRVAQQNAQKASYCDFNF
SVVATSTNSEQVGQVTGEVGSLFIPFNHLSGNISKVTAVTNHFSVWPSSKPMITDAKSTD
LASILLLASLHSRNIHVMSVTSKEDINLIALSKEKGLKVTCDVSIFCLFLSREDFPDCNF
LPSAEDQNALWEHMSTIDVFSIGSIPFQLAGKQASPVSGIAESLPLLFTAVSEGRLTVED
IVSRLYENPKKIFELHDQADTSVEIEVDRPYLFQSPYWSPFNGKSLRGAVQRVTFQGKTS
CLDGEVTRDAPKGTDMSGHRIVPASPSVKAMSPMVQARPESSLDRRLSISGTPGRSFKQR
PADSAANELGPPLYAPVQTSSSLHDLLSRSTFRQKHVISVNQFNRADLHLLFTVAQEMRL
GVQRQGVLDILKGRVLTTLFYEPSTRTSASFDAAMQRLGGRTIAISTEHSSTKKGETLQD
TVRTLGCYGDAVVLRHPDPSSAETAAKFSPVPVINGGNGSVEHPTQAFLDLFTIREELGT
VTGLTITFTGDLRYGRTIHSLIKLLQFYHVRIQLVAPKDLSLPEEVRQTVVASGQLVLES
EELTPEIVARSDVLYCTRVQKERFADLEQYERLKNSFIIDNALMKHAKSHMVVMHPLPRN
AEIAEEVDFDQRAAYFRQVSCLSFSSLVCVELC
NT seq 6762 nt NT seq  +upstreamnt  +downstreamnt
atgccacagtctgccggtaacgacgaggtcgctctcccctccagccctttgtctggaggg
gctgtgtcctacaatcagatcaacaaagaactacagccactcccatcaatggattcagga
aatggagccgtgattccgccagcttctgcccgagtaagaggcagcagcggcaagatgttc
gccctcgaacttgaggatggcacaatctaccagggctacagctttggtgctgagaagagt
gtggcaggagagttggttttccagaccggtatggtgggatacccagagtcgatcactgat
ccctcctaccgcggtcagattctggtcatcactttccctctggtgggcaactacggtgtg
ccctcccgtgagaccatggacgagcttctgaagacattgcccaaatattttgagtctaca
gagatccatgttgcggctctcgttgttgcaacgtacgccggagaggattactctcacttc
ctcgccgagtcgtccctcgggcagtggctcaaggagcagggcgtccccgccatgcacgga
gtggacacccgtgctctgactaagcgcatccgtgaaaaggggagcatgctcggccgcatg
atgctttcaaagtctgaaatcgccgatggtgtcgtggagatgactccaggtgacaaagac
agctggaggtcatccttcgaacaggtcgaatgggtagatcccaacaagaagaacctcgtg
agtgaagtttcgatccgtgagcctcgccttttcacaccccccgagaatgtcgcactcaaa
cacccatctggccgcccggttcgtgtcctttgcttggacgttggtatgaagttcaaccag
ctgcgttgcttgcttgctcgtggtgttgaggttctcgttgtgccgtgggactacgatttc
cccaagcttgccggcaaggactacgacggtctgtttgtgtcgaacggtcctggtgaccca
gcgatgctctctgaaactgtgaacaatctgtccaagaccctgaaggaggccagaactcct
gtctttggtatttgcttgggccaccagttgattgctcgttccgttggtgcccagacgctc
aagatgaagttcggtaaccgcggtcacaacatcccctgtaccagcatgctgtcgggcaag
tgccacatcacctcccagaatcacggttacgctgtcgattcctcgactctcccagagggc
tgggaggaacttttcgtcaacgcaaacgatggcagcaatgagggtatccggcatgtgagc
cgccctttcttcagtgtacaattccatcccgaaagcactcctggtccccgggacactgag
tacctcttcgatgtgttcatcaacactatcaaggacactcttacctcttctgatgctctt
cagaagcctgtctctttccctggcggaacgaaggcagagaacatcaagacatcgccacgt
gtctctgtcaagaaggttttgatcctgggaagcggtggcctcagcattggtcaggctgga
gaattcgactactctggtagccaggctatcaaggccttgaaggaagaaggaatctacact
atcctcatcaatcccaatattgccactatccagacttccaagggtcttgcggataaggtt
tacttcctcccggtcaacgccgagttcgtgcgcaaggtcatcaagcacgagcgccctgat
gccatctatgtcacatttggtggtcagaccgcccttcaagtcggtatccagctcaaggat
gagtttgaatccctcggtgtcaaggtccttggtacgcccattgacaccatcatcacgacc
gaggaccgtgagttgtttgctcgaagcatggagtccatcaacgagaagtgcgccaagtct
gcgtctgcttccaacctggaggaggctctcagagttgttgaggatatcggattcccggtc
atcgtccgtgctgcctatgcgctcggaggtcttggcagtggcttcgctgataacttggat
cagttgaaggagctgtgcaccaaggctttcgccgtcagcccccaggtcctgatcgaaaag
agtatgaagggctggaaggaaattgagtatgaggtagtccgtgattgccaggacaactgc
atcactgtctgcaacatggagaactttgatcctctcggtattcacactggtgactctatt
gttgttgcaccttcgcaaactctgtctgatgaggattacaacatgctgcgtaccaccgcc
gtcaatgtcattcgacaccttggcgttgtcggagagtgcaacattcaatatgctttgaac
cccttctcaaaggaatactgcatcattgaggtcaacgctcgtctgtccagatcttctgcc
cttgcttccaaggccaccggttatcctcttgccttcatcgccgctaagcttggtctgggt
attcctctcaacgagatcaagaactcagtcactaaggtcacttgtgcctgcttcgagccc
tctctagactactgtgtggtgaagattccccgttgggatcttaagaaattcactcgtgtg
tcgacccaacttggctcttcgatgaagagtgttggtgaggttatggccattggacgtacc
tttgaggaagcgattcagaaagccattcgctctgttgacttccacaacttagggttcaat
gaaaccaatgcactgatgtccatcgatcaggagctccagacaccttcagatcaacgtcta
ttcgccattgccaacgccatggctgctggctacagcgtcgacgacatctggaagcttact
aggattgataagtggttcctcgccagactcaagcgcttgagtgactttggcaagctcatg
agcacctacaatgcaactactgttcctcgtcctcttctgcgcgaggccaagcagctcggt
ttctctgatcgccaactcgccaagttcctgagttcgaacgagctgtccatccggcggcta
cgtgttgaagctggcattatccccattgtcaagcagattgacaccgttgctgctgaattc
ccttcagtgaccaattacttgtacctcacatacaacgcatctgcccatgatgttgctttc
gacgataatggtatattggtcttagggtctggtgtgtacagaatcggttcctctgttgag
ttcgactggtgttctgtgcgcactattcggactctccgtgagcagggcctcaagactgtc
atggtcaactataaccctgaaactgtcagtaccgattacgatgaggctgaccggttgtac
tttgaaaatatcaacctcgaaaccgttctcgacatctatcaactggagtcctctagtggc
gtggtcatttcgatgggcggtcaaaccccgaacaacatcgccctgcccctccaccgcctc
aatgtcaagattctgggtacctctcctgagatgattgacagcgcggagaatcgttacaag
ttctctcgcatgcttgaccgtatcggcgtggatcaacctgcctggaaggagcttaccagc
atcgaggaggccaagggattctgcgacaaggtcggctacccagtgcttgtccggccctcc
tacgtgctttcgggagctgccatgaacaccgtctattccgagcacgatcttgctacctat
ctcaaccaggccgctgatgtttcacgtgagcaccccgtcgttatcaccaagtacatcgag
aacgccaaagagattgagatggatgccgtggctcgtaacggtgtcatggtcggacatttt
atctctgagcatgttgagaacgccggtgtccactcgggagacgcaaccctgatcttgccc
cctcaggatcttgaccctgagaccgttcgacgcatcgaagaggccactgctaagatcgga
aacgctctgaacgtcactggtcccttcaacattcaattcattgccaaagacaacgatatc
aaggtcattgagtgcaatgtcagagcttctcgttcattccccttcgtgtcgaaggtcatg
ggtgtcgacctgattgagatggctaccaaggcgatgatcggcaagcctttcgctgagtac
cctccagttaccatccctaagaattacgttggtgtcaaggtccctcagttctctttctct
cgtctctccggtgccgacccagttctgggcgttgagatggcttctaccggagaagttgct
tcctttggtcgtgacaagtacgaggcttatctgaaggctctgatctccaccggtttccgt
cttcccaagaagaacgtcttgttctcgattggttcttacaaggagaagatggagatgttg
ccgtccatcaagaagttgcaccagttgggatttaatctctttgctacttctggtactgcc
gacttcctaaaggaacacggtgtacctgtcaagtatctggaggttcttcctggtcaggaa
gatgaccttaagtccgagtactcccttactcagcacttggcgaacaacctcattgacctc
tatatcaacttgccatccaacaaccgcttccgacgtcctgcgaactacatgagtaaaggc
taccggactcgtcgtatggcagtcgactaccagactcctctggtcaccaacgtgaagaac
gccaaaatcttgattgaagccatcgcccgccacttcgctctgaacgtgcagaccattgac
tatcagaccagccatcgcaccatcatcttgcctggcttgatcaacataaccgccttcgtc
cctggactggtcactcccggttccaatgactttgaacttgtcaccaaggcttcgattgct
gctggtttcagcatgattcgcgtcatgcccgtgggtgttgacgcttctgtcacggatgct
cgcgctctcagagttgcccagcagaatgcccagaaggcctcgtactgtgacttcaacttc
tccgttgtggcgacttccaccaattccgagcaggtcggccaagtcaccggagaggtgggc
tctctgttcattcctttcaaccatctgtctgggaacatcagcaaggtcactgctgtgact
aaccacttctcggtgtggccctcgagcaagcccatgatcaccgacgccaagtctaccgat
ctcgcatcaatcttgttactggcgagcctccatagccgcaacattcacgtcatgagcgtc
acctcaaaggaagatatcaacctcatcgctcttagcaaggagaagggtctgaaggttacc
tgcgacgtctcaatcttctgtctcttcctctctagagaagatttccccgactgcaacttc
ttgccgtctgctgaggaccagaacgccctgtgggagcacatgagcaccattgatgttttc
tccatcggcagtatccccttccaacttgctggcaaacaggcctctccggtttctggtatt
gccgagtcgctgccattgctcttcaccgccgtgtcggagggtcgccttaccgtggaggac
attgtttctcgcctttacgagaaccccaagaagatcttcgagctccatgaccaagccgac
acttctgttgagattgaagttgaccgcccatacctcttccaaagcccgtactggtctccc
ttcaatggcaagagcttgcggggtgctgttcaacgggttaccttccagggcaagacctct
tgcctcgatggtgaagtgactcgcgatgctcccaagggaaccgatatgtctggccatcgt
attgtgcctgcatctccgtctgtcaaggccatgtctcccatggtccaggctcgcccggag
agttctcttgacagacgactgtcgatttcgggaactccaggtcgctcgttcaagcaaagg
cccgctgattcggccgccaatgagctcggtcctcctttgtatgctcctgtacagacttcc
tcctccctgcacgatttgctgtcgcggtcgaccttcagacagaagcatgttatctccgtc
aaccagttcaaccgtgctgacctgcacctgctcttcacggtggctcaggagatgcgtctc
ggcgttcagcgccagggtgttcttgacattctgaagggtcgtgtccttaccactctcttc
tatgaaccttcgacccgcacttcggcatcctttgatgctgccatgcagcgtctcggcgga
cggactattgccatctccaccgagcattcttctaccaagaagggtgagaccttgcaggac
actgtccgcaccctgggttgctacggagatgcagttgttctgcgtcaccccgatcccagc
agcgctgagacggctgccaaattctcgccagtgccggtcatcaacggcggaaatggcagc
gtcgagcaccccactcaggcattcctcgatctcttcacgattcgggaagagcttggaact
gtcactggcttgacgatcacctttactggtgacctcagatatggacgcaccatccactct
ctcatcaaactgctccagttctatcacgtgcgcatccagctcgttgcgcccaaggatctt
tctcttcccgaggaagtccgacagacagtcgtcgcgtccggacagctggtgctcgagtct
gaggagttgacaccagagattgttgcacgctccgatgtcctatactgcactcgtgtgcaa
aaggagcggttcgctgatctcgagcagtacgagcgtcttaagaacagtttcatcattgac
aacgctctcatgaagcacgccaagagccacatggtcgtgatgcacccgctgcccaggaat
gcagagatcgccgaggaggttgatttcgaccagcgggcggcttacttcagacaggttagt
tgcttgtctttctcgtctctcgtttgtgtcgagttgtgctga

DBGET integrated database retrieval system