KEGG   Aspergillus fumigatus: AFUA_6G11600Help
Entry
AFUA_6G11600      CDS       T01017                                 

Definition
endoglucanase (EC:3.-.-.-)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
afm  Aspergillus fumigatus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:afm00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 397 aa AA seqDB search
MKASTIICALLPLAVAAPNAKRASGFVWFGSNESGAEFGETKLPGVLGTDYIWPDASTIK
TLHDAGMNIFRVAFRMERLIPNQMTGTPDATYLNDLKATVNAITSLGAYAVIDPHNYGRY
YGNIISSTDDFAAFWKTLAAQFASNDHVIFDTNNEYHDMDQTLVLNLNQAAINAIRAAGA
TSQYIFVEGNSWSGAWTWTTVNDNLKALTDPQDKIVYEMHQYLDSDGSGTSATCVSSTIG
QERVQAATQWLKTNGKKGIIGEFAGGANSVCQSAVTGMLDYLSANSDVWMGAAWWAAGPW
WADYIFNMEPPSGTAYQNYLSLLKPYFVGGSGGNPPTTTTTTTQPTTTTTTTTAGNPGGT
GLAQHWGQCGGIGWTGPTACASPYTCQKLNDYYSQCL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcttccactattatctgcgcacttctcccccttgctgtggcggcgccgaatgcg
aagcgggcttctgggtttgtctggttcggaagtaacgagtctggcgctgagttcggagag
accaagctgcctggcgtgctggggacggattatatctggcccgatgcgtcgacgatcaag
actctgcatgatgcggggatgaacatcttccgggttgctttccgcatggagaggctgatc
ccgaatcagatgacggggactccggatgcgacgtacctgaatgatctcaaggcgactgtc
aatgcgattacgagtctgggggcgtacgcggttattgatccccataactatggaagatac
tacgggaacatcatctcgtcgactgacgactttgccgcgttctggaagactctggctgcc
cagtttgcgtccaatgaccatgtcatttttgacaccaacaacgagtaccatgacatggac
cagacgctcgtgctcaacctcaaccaggctgccatcaacgccatccgtgctgcaggcgcc
acgtcgcagtacattttcgtcgagggcaactcgtggtccggcgcgtggacctggaccacc
gtcaacgacaacctcaaggccctcaccgacccgcaggataagatcgtctacgagatgcac
cagtatctcgactccgacgggtccggcacgtcggccacctgcgtgagctccaccatcggc
caggagcgcgtgcaggccgccacacagtggttgaagaccaatggtaagaaaggtatcatt
ggcgagttcgctggaggcgccaacagcgtgtgccagtccgctgtcacaggcatgcttgac
tacctgtctgccaactcggatgtgtggatgggcgcggcatggtgggccgctggtccctgg
tgggcagattacatcttcaacatggagccgccgtcgggtactgcctatcagaactatctc
tcgttgttgaagccgtatttcgtcggtggttcgggtggtaaccccccaacgaccaccaca
actaccacccagcctactaccaccactaccacgaccacggccgggaaccctggtggcacc
ggactcgcacagcactggggccaatgcggtggaatcggatggaccgggccaacagcctgc
gcgagcccctatacctgccagaagctgaacgactactactctcaatgcctgtag

DBGET integrated database retrieval system