KEGG   Aspergillus fumigatus: AFUA_6G11620Help
Entry
AFUA_6G11620      CDS       T01017                                 

Definition
formyltetrahydrofolate deformylase (EC:3.5.1.10)
Orthology
K01433  
formyltetrahydrofolate deformylase [EC:3.5.1.10]
Organism
afm  Aspergillus fumigatus
Pathway
Glyoxylate and dicarboxylate metabolism
One carbon pool by folate
Class
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:afm00630]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:afm00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 292 aa AA seqDB search
MDSFILTLSCPDRPGIVHAVTAFLVARNLNIVDSSQFGDPTSKRFFMRMHFAASASATEA
TEEHPKLSVEDLRAAFEPTAKSLAMDFAIHPAAQKPRVLIMVSKIGHCLNDLLFRQSTGQ
LAIEVPLIISNHPDFAPLAATYNVPFVHLPVTPDTKQQQETRVLELVREHQIDLVVLARY
MQVLSPMLCEALSGRIINIHHSFLPSFKGAKPYHQAYDRGVKIIGATAHFVTSDLDEGPI
IEQNVVRVNHALSPKELTHAGSNVESNVLATAVKYVTERRVLLNGHKTVVFA
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggacagcttcatcctcaccctctcctgcccggaccgccccggcattgtccacgctgtg
accgccttcctggttgcgcgcaacctcaacatcgttgactcatcgcaattcggcgatccc
acctcgaagcgcttcttcatgcgcatgcacttcgccgcctccgcgtctgccaccgaggcc
accgaggagcaccccaagctgagcgtcgaggacctgcgcgccgccttcgaacccaccgcc
aagtccctggccatggactttgcgatccaccccgccgcccagaagccccgcgtgctcatc
atggtctccaagatcggccactgcctcaacgacctgctcttccggcaatccaccggccag
ctggccatcgaggtgccgctgatcatctcgaaccacccggacttcgcgcccctcgccgca
acctacaacgtgccgtttgtgcacctgcccgtcacgccggacaccaagcagcagcaggag
acgcgcgtgctggagctggtgcgcgagcaccagatcgacctggtcgtgctggcgcggtac
atgcaggtgctgtcgccgatgctgtgcgaggccctgtcgggccgcatcatcaacatccac
cacagcttcctgccgagtttcaagggcgccaagccctaccaccaggcgtatgaccggggg
gtcaagatcattggtgccacggcgcactttgtgacgagtgacctggatgaggggccgatc
atcgagcagaatgtcgtaagggtgaaccatgcgctgagtcccaaggagttgacgcatgcg
ggcagcaatgtcgagagtaatgtgctggcgacggcggtcaagtatgtgaccgagcggagg
gttttgctgaatgggcacaagacggttgtttttgcttaa

DBGET integrated database retrieval system