KEGG   Aspergillus fumigatus: AFUA_6G11620Help
Entry
AFUA_6G11620      CDS       T01017                                 

Definition
formyltetrahydrofolate deformylase (EC:3.5.1.10)
Orthology
K01433  
formyltetrahydrofolate deformylase [EC:3.5.1.10]
Organism
afm  Aspergillus fumigatus
Pathway
Glyoxylate and dicarboxylate metabolism
One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AFUA_6G11620
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    AFUA_6G11620
Enzymes [BR:afm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.10  formyltetrahydrofolate deformylase
     AFUA_6G11620
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 292 aa AA seqDB search
MDSFILTLSCPDRPGIVHAVTAFLVARNLNIVDSSQFGDPTSKRFFMRMHFAASASATEA
TEEHPKLSVEDLRAAFEPTAKSLAMDFAIHPAAQKPRVLIMVSKIGHCLNDLLFRQSTGQ
LAIEVPLIISNHPDFAPLAATYNVPFVHLPVTPDTKQQQETRVLELVREHQIDLVVLARY
MQVLSPMLCEALSGRIINIHHSFLPSFKGAKPYHQAYDRGVKIIGATAHFVTSDLDEGPI
IEQNVVRVNHALSPKELTHAGSNVESNVLATAVKYVTERRVLLNGHKTVVFA
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggacagcttcatcctcaccctctcctgcccggaccgccccggcattgtccacgctgtg
accgccttcctggttgcgcgcaacctcaacatcgttgactcatcgcaattcggcgatccc
acctcgaagcgcttcttcatgcgcatgcacttcgccgcctccgcgtctgccaccgaggcc
accgaggagcaccccaagctgagcgtcgaggacctgcgcgccgccttcgaacccaccgcc
aagtccctggccatggactttgcgatccaccccgccgcccagaagccccgcgtgctcatc
atggtctccaagatcggccactgcctcaacgacctgctcttccggcaatccaccggccag
ctggccatcgaggtgccgctgatcatctcgaaccacccggacttcgcgcccctcgccgca
acctacaacgtgccgtttgtgcacctgcccgtcacgccggacaccaagcagcagcaggag
acgcgcgtgctggagctggtgcgcgagcaccagatcgacctggtcgtgctggcgcggtac
atgcaggtgctgtcgccgatgctgtgcgaggccctgtcgggccgcatcatcaacatccac
cacagcttcctgccgagtttcaagggcgccaagccctaccaccaggcgtatgaccggggg
gtcaagatcattggtgccacggcgcactttgtgacgagtgacctggatgaggggccgatc
atcgagcagaatgtcgtaagggtgaaccatgcgctgagtcccaaggagttgacgcatgcg
ggcagcaatgtcgagagtaatgtgctggcgacggcggtcaagtatgtgaccgagcggagg
gttttgctgaatgggcacaagacggttgtttttgcttaa

DBGET integrated database retrieval system