KEGG   Aspergillus fumigatus: AFUA_6G12270Help
Entry
AFUA_6G12270      CDS       T01017                                 

Definition
ubiquitin C-terminal hydrolase (EC:3.1.2.15)
Orthology
K11849  
ubiquitin carboxyl-terminal hydrolase 25/28 [EC:3.1.2.15]
Organism
afm  Aspergillus fumigatus
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 1204 aa AA seqDB search
MTKSNQSFLPQAEQKRSTGNPSKVSAVCWKCRYHLQLVVSSTPGIGQSSQGFADHLHHLV
YKSGRQKGGASPAEITPKGQTVETFQYECSYLTCPVTVAVRIASPILADEWVRQLVDPDL
LRQRADEAIATHPERLEGVGRPSPITVLENLRTYISNALHNSQQSKSISAINKRFMTCFG
VEGRPCKDLLEFLGFSVKNEGFWEPPKPNPWAEYPYQDQLKIFLDDVIHELSALIEQRPL
AEKKSHQVQNTDTPALSDILYAMDALDYPKALRANEFQMAPAPYYEDLGVVEDMSASSVV
EAFNRQVSIDPARSPLYLQCLKSIGNLRGGDDAQIIETAVQLAYAEGRYTQEDIVDAYRY
FGLDHNDPRLTDESIIGKFYAFMSSTTQENESRIRLWRIGDSRRSERIKSVAEDRVTNVE
QAEIFLGVDSTTSDEFVLTMYTTKVNDNPETRDIARRAVELIAEGRNSAVLRHFLKTGEM
TTGEMDVADAYRLLQIPDRTVDDAAIMAAYTICVDEAPGQAERYYQALSIIAKEKNSSLL
SSMIAGPGAESGRDLSEWPVGLQNIGNTCYLNSLLQFYFSIRPFREMVLDFESFRMELDD
ESLSKKRVGSREVLKKEVERSQTFLRELRTLFQNMITSSNSFVTPRPELARLTLISPSNE
AAIRRRSTISMTRPGGLGEINGMPIMGPLGPPLPMADQTQSPTDAETETPKRKTTSDVDS
EATLVSETAKPDTSLGPSEDKENEVPPADAMLTDIPVSQDIESNLSPKDETPAIAFGPPN
QPPPVPPRPTIQVDPQKQLLEEVEIGAQQDVTEVINNVLFQSQCAIKPIAFAQDGEQLDQ
VKDLFYGRTKSYILAEAGARSKEEWWCDIKVDVATGPRDIYSAIDGAFDAQKVNVDDTVV
EQFGAISKLPPVLQIQVQRVQFDPVKKSSFKSTHHLELKETIYLDRYMDTQHPEIMNRRR
QCWEWKNTLKTLEDRRAELLRQTENDGLDMATLFDSARAVIEDLDQLKADPETADDGLDF
NPQLPSELAQLSQIAKAELNYVEQEIKDTQTMISSQFVDFKHLAYRLYAVFVHHGSVEFG
HYYIYIFDFRKNVWRKYNDTEVTEVTNTDEIFKNQERQNPPTPYFLVYVNDGLKGRLADP
VCRHIIEDPAPSETIPSTEPIVHMEGVAAATLTSQQDLDTEPPAYDEALADTQNSGTKAV
LDVK
NT seq 3615 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaatcgaatcagagcttcctaccccaagcggagcagaaaaggagcaccggaaat
ccctccaaagtgtcagcggtatgctggaagtgtcgatatcatcttcaacttgttgttagc
tcgactcccggcattggtcaatccagtcaagggttcgcggatcacctgcatcatctggtc
tataaatctggaaggcagaaaggaggcgcttcgccagcggagataacgcctaaaggacag
actgtggaaacctttcaatacgagtgttcatatctcacatgtcctgtgacggtggctgtg
cgaatcgcatcgccaattcttgctgacgaatgggtgcggcagctggtagaccccgatctg
ctgcggcagcgggcggatgaggctattgcgacgcatcctgagcgtttggaaggtgttggt
cgaccgtcgcctattacggttctagagaatcttcgcacttacatatccaatgcccttcac
aacagccagcagagcaaatctatatctgcgataaataagagattcatgacttgtttcggc
gtcgaaggaaggccgtgtaaagatctgttggaattccttggtttttctgtgaagaatgag
ggattttgggagcctcccaaaccaaatccttgggcggagtatccttatcaggatcaactg
aagatatttctcgacgacgttatacatgaactctccgcacttatagagcagcgaccgttg
gcagagaagaagtctcatcaggtgcagaataccgacactccggcgttgagtgatatcctc
tatgcaatggatgctttagattatcccaaagctctgagggcgaatgagttccaaatggcg
cctgcaccttactacgaagatttgggtgtcgtggaggacatgtccgcatcgtcagttgtg
gaagccttcaataggcaagtttccatcgatccagcaaggtcaccgctttacctacagtgt
ctcaagtctattgggaacttgaggggtggcgatgatgcccagatcatagaaacggcggtt
caattagcctacgctgagggtcgatacactcaggaggatattgtggatgcttacaggtac
ttcggacttgatcacaatgaccctcgcctcaccgatgaaagcataattgggaagttctac
gcttttatgagttctactacacaggagaatgaatcgcgcattcgtctctggagaatcggg
gatagcagaagaagtgagcgtatcaagtccgtggcggaagacagggtcaccaatgttgag
caggccgagatcttcctcggcgtcgatagcacaacaagcgatgagttcgttctgaccatg
tataccacgaaggttaatgacaacccggagactagggacattgcacggcgtgctgtcgag
ctcattgcagaaggccgaaattcggctgtcttgagacattttctcaagaccggcgaaatg
acaaccggggaaatggatgtcgccgacgcctatcgcttgctccagattcctgatcggacc
gtggacgatgcagcgataatggcagcttacacaatctgtgttgatgaagctcctggacaa
gccgagcgatactatcaagccttgagcatcatcgccaaggaaaagaatagctctctactc
agcagtatgatcgctgggccgggcgccgaatctggccgtgacttgtccgagtggcccgtc
ggactgcagaacattggcaatacttgctatctcaatagcttactacaattttatttctcc
attcgcccgttccgggagatggtcctggactttgagagtttcaggatggagctcgatgac
gagagtttgagcaagaaacgtgttggttcccgcgaagtcctgaaaaaagaggttgagcgg
tctcagacgttcctgagagaattacggacgctgtttcaaaacatgatcacttcatcaaat
tcttttgtgactcctcgtccggagttagcacgtttgacgctaataagcccgtccaacgag
gcagcaattcggcgccggtcgacgatatctatgacccgacctggcggactgggagagatc
aacggcatgcctatcatgggtcccctcggcccgccactgccaatggcagatcaaactcaa
agtccaacagatgccgagacagagacgcccaaacgtaaaacaacaagcgacgtggatagc
gaagcgacccttgtctcagagactgccaagccagatacgtcgttgggtcccagtgaggac
aaggaaaacgaagtcccccccgcggatgccatgttgacagatatcccagtatcccaagat
attgagagcaatctttctcccaaagatgagacgccggctatcgctttcgggccaccgaac
cagccccctccagtacctccgcgaccaacaatacaagttgatccacaaaagcagcttctg
gaggaggtagaaatcggtgctcaacaggatgtcaccgaagtgatcaacaatgtccttttc
cagagccaatgcgcaatcaagccgatcgcgttcgcccaggacggtgaacaacttgatcag
gtgaaagacctattctatggacggaccaagtcatatattctcgcggaagcaggtgctcgg
tccaaggaggaatggtggtgcgatatcaaggtcgacgtcgcgacgggacctcgtgatatt
tattcagcgattgatggcgcatttgatgcccaaaaagtcaatgtcgatgataccgtcgtg
gagcaattcggtgccatcagcaagctacctccggtccttcaaatccaagtgcaacgggta
caatttgacccagtcaagaagagctctttcaagtccacgcatcaccttgagctcaaggaa
acgatctaccttgatcgttatatggacacgcagcatcctgagatcatgaatcgacgacgg
cagtgctgggaatggaagaatacgctgaagacacttgaagatcgccgtgccgagctgcta
cgtcaaaccgaaaatgacggccttgacatggcaaccctctttgatagcgctagagcggtt
attgaagatttggatcaactaaaggcggatccagaaactgctgacgatgggctcgacttc
aacccacagcttccatctgagctagcccaactctctcagattgcaaaagccgaattgaac
tatgtcgaacaagagatcaaagatacacaaactatgatctccagtcagtttgtcgacttc
aagcatctggcctatcggttatatgcggtcttcgtgcaccatgggtctgttgagttcggc
cattattatatctatatttttgatttcaggaagaatgtctggcgcaaatacaacgacact
gaagtcaccgaggtgaccaacacggacgagatttttaagaaccaagaacgccaaaaccct
cctaccccatactttctggtttacgtcaacgatggcctcaagggtcgcctggccgatcct
gtttgcaggcacattattgaagatcctgcacccagcgaaactatcccttcaacagaaccc
attgttcacatggaaggggttgctgcggcaactttgacatctcaacaggacctggacacg
gaacctcctgcctacgatgaggctctggctgatactcagaattcaggtacgaaagctgtc
ctcgatgtaaagtga

DBGET integrated database retrieval system