KEGG   Aspergillus fumigatus: AFUA_6G12800Help
Entry
AFUA_6G12800      CDS       T01017                                 

Definition
uroporphyrinogen-III synthase (UroS) (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
afm  Aspergillus fumigatus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AFUA_6G12800
Enzymes [BR:afm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     AFUA_6G12800
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 341 aa AA seqDB search
MTTSPSYAFSSSSATPILLLKTKSTPHDGYEEFFSAHGYNPAFVPVLEHHFHQTNLHTVK
DLFTSGSLNAGPRRKYGGLIFTSQRAVEGFARLVTSEVDATAASHSLILYTVGPATSRSL
TTLRDSHLPHATIYGSDAGDGQKLALAILEHYNALYDSGGVDASTGAPPVKPPLLFLVGE
QRRDIIPRTLMDESLSPAKRIQVDELVVYETGVMESFRGDFQAAVRAGQEYLALAGQDRD
ADGKNVAIWVVVFSPTGCDAMLRVLGLLSTSTEPSAGGADTLVDGSASRTERRFFIATIG
PTTRDHLVKNYGFQPDVCAEKPSPEGVGAGIEAFLRRWKGI
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgacaacctcaccttcatatgccttctcatcctcatcagcaacgcccatcctgctcctc
aagacgaaatctaccccgcatgatggctacgaggaattcttctccgcccacggctacaac
cccgccttcgtcccagtcctcgagcaccatttccatcagacgaacctccacaccgtaaag
gatctcttcacgtcgggcagtctaaatgccggcccgcgacggaaatacggcgggctgata
tttaccagccagcgcgctgtagaggggttcgcgcgcttggtcacgtccgaggtggatgcg
acagccgcatcccactccttgatactgtacaccgtcgggcccgcgacatcccgctccctc
actaccttgcgagattcacatctgccccatgcaactatctacggctccgacgctggagac
ggccagaaacttgcgcttgcgatcctggagcattataatgcgctctatgatagcggaggc
gtagatgctagcacaggcgcaccgcccgtgaagccacccctcctcttccttgttggcgaa
cagcgccgcgatatcatacccagaacgctcatggatgagtccctgtcccccgctaagcgg
attcaggtagatgagcttgtcgtttacgagacgggggtgatggagtcctttagaggtgat
tttcaggctgcggtacgcgccggacaggagtatttggctctggctggtcaggatcgggac
gctgatggaaagaacgtggcgatctgggttgtggtattttcgccaacaggctgtgatgcg
atgcttcgtgttttggggttgctttctacgtctacagagccctctgccggaggtgcggat
acgctggttgatgggagtgcaagcaggacggagaggaggttcttcatagcaactattggg
cctacgacgagagatcatcttgtcaagaattatggattccaaccggatgtttgcgcggag
aagcctagtccggaaggtgttggtgctggcattgaagcgttcttacggcggtggaaggga
atatga

DBGET integrated database retrieval system