KEGG   Aspergillus fumigatus: AFUA_6G12820Help
Entry
AFUA_6G12820      CDS       T01017                                 

Definition
MAP kinase MpkB (EC:2.7.11.1)
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
afm  Aspergillus fumigatus
Brite
Enzymes [BR:afm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     AFUA_6G12820
Protein kinases [BR:afm01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   AFUA_6G12820
Exosome [BR:afm04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AFUA_6G12820
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 353 aa AA seqDB search
MVQQPPQGGSRKISFNVSEQYEIQDVIGEGAYGVVCSAIHKPSGQKVAIKKITPFDHSMF
CLRTLREMKLLRYFNHENIISILDIQRPRNYESFNEVYLIQELMETDMHRVIRTQDLSDD
HCQYFIYQTLRALKAMHSANVLHRDLKPSNLLLNANCDLKVCDFGLARSAASTDDNSGFM
TEYVATRWYRAPEIMLTFKEYTKAIDVWSVGCILAEMLSGKPLFPGKDYHHQLTLILDVL
GTPTMEDYYGIKSRRAREYIRSLPFKKKIPFKALFPKSNELALDLLEKLLAFNPAKRITV
EEALRHPYLEPYHDPDDEPTAPPIPEGFFDFDKNKDALSKEQLKTLIYEEIMR
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggtgcagcaacctcctcaaggaggatcgaggaagatctccttcaacgtttctgagcaa
tatgaaattcaagatgtcattggagagggtgcttatggtgtcgtttgctcggctatccat
aaaccctctggtcagaaagttgccatcaagaagattacgcctttcgatcactccatgttc
tgtttgcggactttgcgtgaaatgaagttactgcgctactttaaccacgaaaacatcatt
tcgatcttggatattcagaggcctcgcaactatgagagtttcaacgaggtgtatttgatt
caggagttgatggaaaccgatatgcatcgtgtcatccgcacccaggatctctccgatgac
cactgccaatactttatctatcagaccctccgtgcactcaaagccatgcactcagcgaac
gtgcttcaccgtgaccttaagccctcaaatctgctacttaacgccaactgtgacctgaaa
gtctgcgactttggcttggctaggtcggctgcatcgactgatgacaactcaggtttcatg
acggaatacgttgccactcgatggtatcgtgcgccggagatcatgctgacattcaaggag
tatacgaaagccattgatgtctggagtgttgggtgtatcttggccgagatgctgagcggg
aagcccttgttccctgggaaagactaccatcaccaattgaccctcattctggatgttctc
ggaacaccaaccatggaagattactacggcataaaatcgcgccgggctcgagagtacatt
cgctcccttcccttcaagaagaagatcccattcaaggcattatttcccaagagcaacgaa
ctagcattggatctcctggaaaaacttttggctttcaaccccgcaaaacgtatcacggtt
gaagaagctctacgccatccgtatctggagccgtaccacgaccccgacgatgagcccacg
gctccccctattcccgagggcttctttgattttgacaagaacaaggatgctctcagcaag
gagcaattgaaaaccctgatctacgaagaaatcatgcggtag

DBGET integrated database retrieval system