KEGG   Aspergillus fumigatus: AFUA_6G13520Help
Entry
AFUA_6G13520      CDS       T01017                                 

Definition
(RefSeq) tryptophan synthase (EC:4.2.1.20)
  KO
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
afm  Aspergillus fumigatus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AFUA_6G13520
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AFUA_6G13520
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AFUA_6G13520
Enzymes [BR:afm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AFUA_6G13520
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 460 aa AA seqDB search
MIIPATFKPSLTRIRSKRRSKGIKNGDTHSICPACLYHLSIIQGRTTIPSTLLLHHVQLD
TPSESNCLINGETLKECPVWETSPLPCLPILLSPTRFGTFGGRFAPESHMDALQELTLAF
DRFSSDYSFWKEFVSFPGIRPSPLRFAENLTRIAGGANIWLKREDLNQHGSHNIRSIVGQ
ALLARRLGKAEVVMECGSARHGIVCAATCARLSMECTILMGSRDATDQKDSVDMIRKLGA
TVLTADMGASSGRGTLRAAVNEALRYSVAHLSTAYHIMSGPIGPHPLPTITRTFQSILGE
EIKTQFGGASGDRLPDALVSPVGPGSAAVGMFYPFIEHPSVKLLGVEAADAAPLSHDEIG
VLHGCRTYLLQDEHGQILDSSSISPDLDFPSVGPELAHWKETARVEYVTATDTEALRGLD
ILRSQEGIVPGAMTGYAVERTIRLARELGPGKDVVLLVAG
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgattattccggccactttcaagccttctctgacaagaatcagaagcaagagacgcagc
aaggggatcaagaatggagatactcactcgatatgtccagcatgtctctatcatctcagc
attatacaagggaggacgaccatcccttccacgctacttctccatcatgtacagctcgac
acaccttcggagtcaaattgtctgatcaacggagagacacttaaggaatgtccagtatgg
gaaaccagccctctcccctgcctgccaatcctcttgtctccaaccaggttcggcactttt
ggtggccggtttgctcccgagtcccatatggacgccttgcaggagctcacattggcgttc
gaccgtttcagctcagactacagcttctggaaagagttcgtaagcttccccggtatccgt
cctagcccgcttcggttcgcagaaaacctcacgcgcatcgctggcggcgcgaatatctgg
ctcaagcgggaggatctaaaccaacatggtagtcacaatatccgcagcattgtcggtcag
gccctgctcgcacggcggctaggaaaggccgaagtcgtgatggagtgcggctcagctagg
cacggtatcgtctgcgcggcgacctgcgcacgcttgagtatggagtgcaccatcctcatg
gggagccgggacgcaaccgaccagaaggacagcgtggacatgatcaggaaactcggcgcg
acagtcctcaccgcagacatgggggcgtcgtcgggtcgtgggaccctccgagctgcagtc
aacgaggcccttcggtattcagtcgcccatctcagcaccgcataccacatcatgagcggt
ccaatcggtccccacccgcttccaacaatcacacgcaccttccaatcaattctcggcgag
gagatcaaaacgcaattcggcggcgccagcggtgaccggcttccagacgccctcgtctcc
cccgtcggaccaggcagtgcagccgtcggcatgttctacccgttcattgagcatccgtcg
gtgaaactgctcggcgttgaggcggcagacgcagctcccctatcccacgatgaaattggc
gtcctgcatggatgccgcacctatctcctccaggacgagcatggccagatcctcgattcg
agctcgatatcccccgatctggactttcccagcgttggccctgaactggcgcactggaag
gagacggccagggtggaatatgttactgccacggacacagaagccttacggggtctggac
attcttcggagccaggaggggattgtcccgggagcgatgacggggtatgcggttgagagg
acaattcggcttgcaagggaactagggccggggaaggatgttgtcttgcttgtggcggga
tga

DBGET integrated database retrieval system