KEGG   Aspergillus fumigatus: AFUA_7G01010Help
Entry
AFUA_7G01010      CDS       T01017                                 

Definition
(RefSeq) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
afm  Aspergillus fumigatus
Pathway
afm00010  Glycolysis / Gluconeogenesis
afm00071  Fatty acid degradation
afm00350  Tyrosine metabolism
afm01100  Metabolic pathways
afm01110  Biosynthesis of secondary metabolites
afm01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AFUA_7G01010
  Lipid metabolism
   00071 Fatty acid degradation
    AFUA_7G01010
  Amino acid metabolism
   00350 Tyrosine metabolism
    AFUA_7G01010
Enzymes [BR:afm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     AFUA_7G01010
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 2-Hacid_dh_C adh_short
Motif
Other DBs
NCBI-GeneID: 3504138
NCBI-ProteinID: XP_746830
UniProt: Q4WAE4
Position
7
AA seq 353 aa AA seqDB search
MTKFDIPSMQWAQVAEQVGGPLVLKQIPVPKPGPDEILVKIRYSGVCHTDLHAMKGDWPL
PVKMPLVGGHEGAGVVVAKGDLVTEFEIGDHAGIKWLNGSCLACEFCKQADEPLCQNALL
SGYTVDGTFQQYTIGKATHASKIPKHVPLDAVAPVLCAGITVYKGLKESGARPGQTVAIV
GAGGGLGSLAQQYARAMGLRVIAIDGGDEKRAMCEQLGAEAYVDFTKSKDLVADVKAATP
DGLGAHAVILLAVSEKPFQQATEYVRSRGTVVAIGLPANAFLRAPVLNTVVRMINIRGSY
VGNRQDGVEAIDFFARGLIKAPYKVAPLADLPKIYELMEQGKIAGRYVLEMPE
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgactaagttcgacatcccctccatgcaatgggcccaggtggccgaacaggtcggcggc
cctctggtcctcaagcaaatccctgtcccaaagcccggacccgatgagatcctggtcaag
atccgttactcgggcgtctgccacaccgacctccacgccatgaaaggcgactggcctctc
cctgtcaagatgcccctcgtcggtggccacgagggcgccggcgtcgtcgtagccaagggc
gacctcgtcacggaattcgagatcggcgaccacgcaggcatcaagtggctgaacgggtcc
tgtctcgcctgcgagttctgcaagcaggccgatgaaccgctttgccagaatgccttgctg
tccgggtataccgtcgatggcaccttccagcagtacacgattggcaaggcgacgcatgcg
tcgaagattcccaagcacgtgcccctggatgcggtggcgccggtgctgtgcgccgggatt
accgtgtacaaggggctgaaggagtccggcgctcggcctgggcagacggtggcgattgtc
ggtgcgggtggtgggctgggatccctggcgcagcagtacgcgcgggccatgggtttgcgg
gttattgcgattgatggtggggatgagaagcgggcgatgtgcgagcagcttggagccgag
gcatacgttgatttcaccaagtccaaagatctggtcgcggatgtcaaggccgccacgccg
gatgggctgggtgcgcatgcggtgattctcctggccgtctcggagaagcccttccagcag
gcgaccgagtatgttcgctcgcgcgggactgtcgtcgccattggcttgcctgcgaacgcc
ttcctgagggcaccggtcctcaacacggtggtgcgcatgatcaacatccggggcagctat
gttggcaaccgacaggatggcgtcgaggcgattgatttcttcgctcgcggactgatcaag
gctccgtacaaggttgctccgcttgcggatctgcctaagatctatgagctcatggaacaa
ggcaagatcgctggtcgctacgtccttgagatgcccgaatga

DBGET integrated database retrieval system