KEGG   Aspergillus fumigatus: AFUA_7G01480Help
Entry
AFUA_7G01480      CDS       T01017                                 

Definition
cap binding protein
Orthology
K03259  
translation initiation factor 4E
Organism
afm  Aspergillus fumigatus
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:afm00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    AFUA_7G01480
Messenger RNA biogenesis [BR:afm03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     AFUA_7G01480
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     AFUA_7G01480
Translation factors [BR:afm03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    AFUA_7G01480
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 268 aa AA seqDB search
MAEVAENGPVPVNNENTAPGAATEEKEQTEKTEQTNGDAVTVFHDPENFNVKHPLMHEWT
LWFTKPPSGKVRAIAIDIRVDSLTLFDLQGDNWNDLLKEVVTFNSVEEFWGIYNNITPTS
ELGLKADYHLFKKGIRPEWEDPQNKHGGKWSYSFKDKRSVPIDDLWLHAQLAAIGETLEN
DGDNEVMGVVVNVRKGFYRVGLWTRTVGKSIPGDKNGRTPAQGKEILENIGRRFKEVLRL
KEADVVEFSGHTDSAHSGSTRAKAKYTV
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagtcgcagagaacggtcctgtgccggtgaacaatgagaacaccgctcctggc
gccgctactgaagaaaaggagcagaccgagaagaccgagcagacgaatggcgatgctgtt
acagtattccatgaccccgagaatttcaacgtgaagcatccgctcatgcacgaatggact
ctctggttcacgaagccacccagtggcaaggtacgtgccatagccatcgatatacgggta
gactcgttaacactgtttgatttgcagggcgacaactggaacgatctgttgaaggaggtc
gtgactttcaactcggtcgaagaattctggggtatctataacaatatcacaccaacttct
gaactgggtctcaaggcggactatcatctcttcaaaaagggcatcaggccagagtgggaa
gacccccagaacaagcacggtggcaagtggtcatactcgttcaaagacaagcgctccgta
ccgatcgacgatctttggcttcacgctcaactggcagctatcggcgagactcttgagaac
gatggtgacaacgaggttatgggtgtggttgtgaacgtgcgcaagggattttaccgtgtt
ggtctgtggacacggaccgtgggcaagagcattcccggcgacaagaacggccggacaccc
gctcaagggaaggagattctcgaaaacatcggtcggcgcttcaaggaggtgctacgcctg
aaggaagctgatgtcgttgagttctcggggcacacggacagcgcacacagcggtagcact
agagccaaggccaagtacaccgtttaa

DBGET integrated database retrieval system