KEGG   Aspergillus fumigatus: AFUA_7G01710Help
Entry
AFUA_7G01710      CDS       T01017                                 

Definition
cholinesterase (EC:3.1.1.7)
Orthology
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
afm  Aspergillus fumigatus
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    AFUA_7G01710
Enzymes [BR:afm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     AFUA_7G01710
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 733 aa AA seqDB search
MQLKSLAVRLLFCSLVSAAPSQPSNACKAPGGPPQINSLSTLLVLKYNNLGSENNGTAAV
LIYDRVDYGQAQVQCAAIGASLYSLQHATDTNRTELQYQFNYLIQNGDLQRSDHVWVAKL
SSRDCSAYSLSRKETVSIPCHLQLPALCTSKVPPTTDTNRAVVESSKISVMYQGYTLTGY
RDARSFRFLGVPFANPPVKDLRFAPPQPYSGPKTLDATKFSASCVQSVSSFGTLGNSGGI
SEDCLYLNIYTPVLPAHGAHNSLRKPVAVYFYGGAFTKGSASMIDYDGGNFASRNDVVVV
TVNYRLGALGWLATGSLTTGSYGIRDQILALKWINEYIEAFGGDKSRITIFGQSAGGQSV
TALLSSSAAKGLFSGAIVQSAPLDLPWFTREVYKEVVTPGVAKAVGCNQTVSEEKLLACL
RSVPASAFLDNATEFQSAMTAVNKKVADEFLHVSTMLASIEPLMPMVDDSGSGVIDDQFY
TLLADNTLPNRVPTMFTTVTDEAALYVGGFIPQIEASTENLNLLFGIAYPPGLANALAAS
NAFPLNPSDPDTVRNVGAQALTYSEWTCPQAHLLANGGATAFPALYELEITHGHIQTNAG
VPAICSPNTDYNATCHAADVLPVWGTLNSKSRNVDPYYDTTDLLHSQLLDDVFGAFFRTR
SPNPDPEMLRVQGPAYAATYEIFGKNGYYIPPYHPEQRNVSLLDMPPTWTQNPHGTNKCR
VFEEYGFTFQRAF
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgcagctgaagtctttggctgttcgactgctcttctgctcgctggtatctgcggcgcct
tcacagcccagtaatgcatgcaaagccccaggaggtccccctcagatcaattctctgagt
actttgctggtcttgaagtacaataatttgggctccgaaaacaacggtacggccgcggtt
ctgatttatgatcgagtggactacggtcaggcgcaggtgcagtgtgctgccatcggggca
agcctttactccctgcaacatgcgaccgacacaaaccggaccgagcttcaatatcagttc
aattatcttattcagaatggcgatctccagaggagcgatcacgtatgggttgcaaagttg
tcctcaagggactgctccgcctattctctcagccgcaaggagactgtgagcataccctgc
catctgcagctgcccgcgctttgtacgtccaaggttcctcccactaccgacacgaaccgg
gctgttgtcgagtcttccaagatctcggtaatgtatcagggttacactctcactggatat
cgcgacgcacgttcattccggttcctgggtgttccttttgccaacccccctgtcaaagac
ctgagattcgcaccgcctcagccgtacagtggtcccaaaacgctcgatgcgaccaaattc
tccgcctcttgcgtccagtcagtctccagctttggtaccctgggcaacagcggtggcatc
tccgaggactgtttgtatctcaacatctacacccctgtgcttcctgcgcacggcgcccac
aactctttgcgcaaaccggtggccgtctacttctacggaggtgcgtttaccaaaggtagt
gcgtccatgatcgactacgacgggggcaactttgcaagccgcaacgacgttgttgtggtg
acggtcaactaccgcctcggcgccttgggctggttggcaactggcagtctcacgacagga
agctatggcattcgcgaccaaatccttgcccttaaatggatcaacgagtacatcgaagcg
ttcgggggtgacaagtcacgaatcacaatcttcggccagtcagctggcggccagagcgtg
acggccttgctatcatccagcgcagccaaaggtttattctccggtgccattgttcagtcg
gctccgctggatctgccatggtttacccgcgaggtatataaagaagttgtcaccccgggg
gttgccaaggctgtcggctgcaaccaaaccgtctctgaagagaaactgctggcctgtctg
cgctcggtgcccgcatcggccttcctcgacaatgcgaccgagttccagtccgcgatgacg
gccgtgaacaagaaagtcgccgacgagttcctgcacgtctcgacaatgctcgcctccatt
gagcccctaatgcccatggtcgacgactcgggcagcggcgtgattgacgaccagttctac
accctcctcgccgacaacacgctccccaaccgcgtcccaaccatgttcaccaccgtcacc
gacgaagccgccctctacgttggcggatttatcccgcaaatcgaggcatccaccgaaaac
ctcaacctcctcttcggcatcgcctacccccccggcctagccaacgccctcgcggcctcc
aacgccttcccgctcaacccctccgacccagacaccgtccgcaacgtcggcgcccaagcc
ctaacctacagcgagtggacctgcccacaagcccacctcctcgccaacggcggcgccacc
gccttccccgccctctacgaactcgaaatcacccacggccacatccaaaccaacgccggc
gtccccgccatctgttccccaaacaccgactacaacgccacctgccacgccgccgacgtg
ctccccgtctggggcaccctcaacagcaagtcccgcaacgtagacccctactacgatacc
accgaccttctccactcgcagctcctcgacgacgtcttcggcgccttttttcgaacccgc
agtcccaaccctgacccggagatgctccgcgtccaggggcccgcttacgccgcgacctac
gagatcttcgggaagaacgggtactatatccctccgtatcatcccgagcagcgcaatgtc
agtctgctcgatatgccgccgacctggacgcagaatccacatggcacgaacaagtgcagg
gtgttcgaggagtatggatttactttccagcgggccttttga

DBGET integrated database retrieval system