KEGG   Aspergillus fumigatus: AFUA_7G01830Help
Entry
AFUA_7G01830      CDS       T01017                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase Ugp1, putative
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
afm  Aspergillus fumigatus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:afm00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:afm00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:afm00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:afm00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 511 aa AA seqDB search
MPLFSSSSSSSSSANKLTQFPRAQAFENASTSVAASQMRNALNALAETVPDPEEKKRFEA
EMDNFFALFRRFLNDKAKGNVVNWDRINPPAPNQVVDYNDLGAEASVEFLNKLAVVKLNG
GLGTSMGCVGPKSVIEVREGMSFLDLSVRQIEHLNRTYNVNVPFVLMNSFNTDQDTQSII
KKYQGHNVDIITFNQSRYPRIIKDSLLPAPKSFDAPLQDWYPPGHGDVFESLYNSGTLDK
LLERGVEYIFLSNADNLGAVVDLRILQHMADTGAEYIMELTDKTKADVKGGTIIDYEGKA
RLLEIAQVPKEHVNEFKSIKKFKYFNTNNIWMSLRAIKRVVEENELEMEIIANEKSIPAD
KKGEADQAIYQLETAVGAAIRHFKNAHGVNVPRRRFLPVKTCSDLLLVKSDLYRLEHGQL
VMDPNRFGGVPVIKLGSDFKKVSDFQKRIPSIPRIVELDHLTITGAVNLGRNVTLKGTVI
IVATEGSTIDIPPGSVLENCVVQGSLRILEH
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgcctctcttttcttcttcttcttcttcttcttcttctgcaaataagctgacccaattc
cctcgtgcgcaggccttcgagaatgcctccaccagtgtcgctgcttctcagatgcgtaac
gctctgaatgcgcttgccgagaccgttcccgaccccgaagagaagaagcgcttcgaggcc
gagatggacaacttcttcgctctcttccgcagattcctcaacgacaaggccaagggcaat
gtcgtcaactgggaccgcatcaaccctcctgcgcccaaccaggtcgtcgactacaatgac
ctgggcgccgaggcctcggtggagttcctgaacaagctggccgtcgtcaagctcaacggt
ggtcttggtacctccatgggttgcgtgggccccaagtccgtcattgaagtccgtgaaggc
atgtccttcttggatttgtccgttcgtcagattgagcacctgaaccgtacctacaacgtc
aacgtgcccttcgttctgatgaactcgttcaacaccgaccaggacacccagtccatcatc
aagaagtaccaaggccacaacgtcgacatcatcaccttcaaccagtcccgctaccctcgt
atcatcaaggactctctcctccccgctcccaagagctttgacgctcctctgcaggactgg
taccctcccggtcacggtgacgtttttgagtcgctgtacaactcgggcactctggacaag
ctgctcgagcgtggtgttgagtacatcttcctctccaatgccgacaacctcggcgccgtt
gtggatctccggattttgcagcacatggcggacactggtgccgagtacattatggagttg
accgacaagaccaaggccgacgtcaagggtggtaccatcattgactacgagggtaaggcc
cgtctgctcgaaatcgcccaggtgcccaaggagcacgtcaacgagttcaagtccatcaag
aagttcaagtacttcaacaccaacaacatctggatgagcctccgcgccatcaagcgtgtt
gttgaggagaacgagttggagatggagatcattgccaatgagaagtccatccccgccgac
aagaagggcgaggccgaccaggccatctaccagctggagaccgccgtcggtgcggccatc
cgccacttcaagaacgctcacggtgtgaacgttccccgtcgccgtttcctgcccgtcaag
acttgctccgatctcttgctggtcaagtcggatctctaccgtctcgagcacggtcagctc
gtcatggaccccaaccgtttcggcggtgtccccgtcatcaagcttggatcggacttcaag
aaggtgtcggacttccaaaagcgcatccccagcattcctcgcatcgtcgagctggaccac
ctcacaatcaccggtgctgtcaacctcggccgcaatgtcaccctgaagggtaccgtcatc
atcgtcgccaccgagggcagcacgatcgacattccccctggttcggtcctggagaactgt
gtggtccagggcagcttgagaatcctggagcactaa

DBGET integrated database retrieval system