KEGG   Aspergillus fumigatus: AFUA_7G05920Help
Entry
AFUA_7G05920      CDS       T01017                                 

Definition
stearic acid desaturase (SdeA) (EC:1.14.-.-)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
afm  Aspergillus fumigatus
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:afm01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:afm01040]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 456 aa AA seqDB search
MSAKPADASRPRAGDPKKVHIADTAITRQNWYKHVNWLNVFLIIGIPLYGCIQAFWVPLQ
LKTAIWAVVYYFFTGLGITAGYHRLWAHCSYSARLPLRIWLAAVGGGAVEGSIRWWARDH
RAHHRYTDTDKDPYSVRKGLLYSHIGWMVMKQNPKRIGRTDITDLNEDPVVVWQHRNYLK
VVLVMGLVVPMLVAGLGWGDWFGGFIYAGILRIFFVQQATFCVNSLAHWLGDQPFDDRNS
PRDHVITALVTLGEGYHNFHHEFPSDYRNAIEWHQYDPTKWTIWIWKQLGLAYDLKQFRA
NEIEKGRIQQLQKKIDQKRAKLDWGIPLDQLPVMEWDDYVEQAKNGRGLIAIAGVVHDVT
DFIKDHPGGKAMINSGIGKDATAMFNGGVYNHSNAAHNLLSTMRVGVIRGGCEVEIWKRA
QKESGEYVRDESGQRIIRAGQQVTKIPDPIPTADAA
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcgaagcctgcagatgcttctcgcccgcgggctggtgatcccaagaaggtccat
atcgccgacacggccatcactcgtcagaactggtacaagcatgtgaactggctgaacgtc
ttcctcatcatcggtatccccttgtacgggtgcatccaggctttctgggtgcctctgcag
ctcaagaccgccatctgggccgttgtctactacttcttcaccggtcttggtatcacagca
ggataccatcgtctttgggctcactgctcctactctgctcgtctgcctctgcgtatctgg
ctcgcagccgttggtggtggtgcagtcgaagggtccatccgctggtgggctcgtgaccac
cgcgctcaccaccgttacaccgacactgacaaggatccctactctgttcgcaagggtctc
ctctactcgcacatcggctggatggttatgaagcagaaccccaagcgtattggccgtacc
gacatcaccgatttgaacgaggatcctgttgttgtgtggcaacaccgcaactacctgaag
gtcgtcctggtgatggggctcgttgtgcccatgctcgtggcaggtcttggctggggtgac
tggtttggcggcttcatctatgccggtattctgcgtatcttcttcgttcagcaagccact
ttttgtgtcaactctctggcccactggctcggcgatcagcccttcgacgaccgcaactcc
cccagagatcacgttatcactgctctggtcactcttggcgagggttaccataacttccat
cacgaattcccctcggattaccgcaacgccatcgagtggcaccagtatgaccccaccaag
tggaccatctggatctggaagcagcttggtctagcctatgatctgaagcagttccgtgcc
aatgaaatcgagaagggccgtattcagcagctccagaagaagatcgaccagaagcgtgcc
aagttggattggggtatccctctcgaccagcttcccgtcatggagtgggatgactatgtt
gaacaggctaagaacggccgcggactgattgctattgctggtgttgttcacgatgtgacc
gatttcatcaaggaccaccctggtggcaaagctatgatcaactccggcattggcaaggat
gctactgccatgttcaacggtggagtttacaaccactcaaatgctgcccacaacctgctg
tctaccatgcgtgtcggcgttatccgcggcggctgtgaagttgagatctggaagcgtgcc
cagaaggagagcggcgaatatgtccgcgacgagtccggtcagcgcattatccgcgctggt
cagcaggtcaccaagattcccgaccccattcccaccgctgatgcggcatga

DBGET integrated database retrieval system