KEGG   Aspergillus fumigatus: AFUA_8G01100Help
Entry
AFUA_8G01100      CDS       T01017                                 

Definition
Melibiase subfamily (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
afm  Aspergillus fumigatus
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AFUA_8G01100
  Lipid metabolism
   00561 Glycerolipid metabolism
    AFUA_8G01100
   00600 Sphingolipid metabolism
    AFUA_8G01100
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    AFUA_8G01100
Enzymes [BR:afm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     AFUA_8G01100
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 783 aa AA seqDB search
MEFYNPIDRVSHIIPTYHKMLNEPIDDAHWRNISRDLPCGYLPLIYIRFSRSRKILETPV
TRPVSPKMPPQTITLESQALRVKVLIDNDGAAFLQQVLPLPGTSPNPVSKNFSDSYAPLV
EVRLAGEGTERNKSSKSLVGSYVGSRLRYQSHEIEKGADTQTLHVRLQDGSSGALVTSHL
TVYEGFPVLRATASIQNGGDKDFVVTQLTSLVLGGLSTGSERWWHEYRLSVPNNSWFREA
QWVEHDLPSLGVDDCGVYGRPDEHWGSLTHYSVSKRGTFSTEGHLPMGLLKHVSGKDTWL
WQVENNGSWRWEIGDWKDSIYLAAGGPVETEHDWRERLSPGQKFTTVPVALCHVQDDYEA
AFAAMTRYRRQIRRKHRDHDRLPIIFNDYMNCLMGDPTEEKILALVDPVVNAGAGYFVID
AGWYADDSGWWDDVGLWEPSSKRFPSGFKALLSQIRNKGLIPGLWIEPEVIGVRSAVAKQ
LPNEAFFQRDGHRIVEKNRYQLDYRHPAVREHMSAVIHRLVTEYGVGYFKFDYNIDVTQG
TDINCSSPGSGQLGHNRAYLQWVDELHDRYHDLVIENCSSGAQRMDYAMLAVHALQSSSD
QQDPERYPAIASALPTAVTPEQGAIWAYPQPAWDGELNAMTVVNSLLGRVHLSGRLDLLR
PEQIDLIKEGMDVYRAIRADLPTATAFWPLGLPQWHDDWFSLGMDVTKPEGNGRQCYYLS
IWRRGGPESIDLPVKALCGRAVSTEILYPTSLPAKAVWLSNKGLLEVTIPSAMGARLIKL
TAE
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atggagttctacaatcccattgatagagttagtcatataatacccacctatcacaagatg
ctaaatgagccgattgatgatgctcattggcgcaatattagccgggatctgccctgcgga
tatttacccctcatttatatacgattctccaggtcaaggaaaatcctggagaccccagta
actagacccgtgtcgcctaagatgccgccgcagacaattacactcgagagccaggctctt
cgagtcaaagtactcattgataacgatggggcagctttccttcaacaagtgctgcctctt
cccggcacttcgccaaaccccgtgtcgaagaatttcagtgactcgtatgcaccgctggta
gaggtgcggctggccggagagggaactgaaagaaacaagtcctcgaaaagtctcgtgggg
agctatgtcggctctcgcctgcggtatcagtcccatgagattgagaaaggcgcagatacc
cagacactccatgttcgattgcaggatggtagctccggggcgctggttacatcgcatctc
acagtttacgaggggttcccggttctgcgtgcgacggctagcatccaaaacggtggtgac
aaagacttcgtcgtgacgcagctcacatcgctcgttctcggtgggctatcgactggttca
gagagatggtggcacgagtatagactatctgttccgaacaactcgtggttccgagaagca
cagtgggttgaacatgacctgcccagtctgggggtcgatgattgtggcgtctacggacgg
cccgatgagcactggggaagcctgacgcactattctgtatcgaagcgcggcaccttttca
acggaaggacatctcccaatgggactcttgaagcatgtcagcgggaaagacacctggctt
tggcaggtggaaaacaatggctcgtggcgatgggagataggagactggaaggacagcatt
tatctggctgctggtgggcctgtcgagaccgagcatgactggagggagaggctctcccca
ggccagaagtttactaccgtgcctgttgcgctgtgtcatgtccaggatgactacgaggca
gcctttgccgccatgactcggtacagacgccagatccggcgcaagcaccgggaccacgac
agactgccgatcatcttcaacgattacatgaactgtttgatgggtgatcccaccgaggag
aaaatattagcacttgtagatcctgttgtcaacgcaggcgcagggtactttgtgattgac
gctgggtggtacgcggatgactccgggtggtgggacgatgttggattgtgggagccatct
tcgaagaggttcccatcgggattcaaggcccttctaagccagatccggaacaaaggattg
attccaggactatggatcgagcctgaagttattggagtccgcagcgccgtggcaaagcag
ctcccaaacgaagcgttcttccagcgagatggtcatcgcatcgtggagaagaatcgatac
caactcgattaccgtcatcccgccgtacgagagcacatgagcgccgtcattcatcgtctt
gtgactgaatacggcgttggctacttcaagttcgactacaacatcgatgtcacccagggg
acagacatcaactgctcaagtcctggctccggccaactaggacataaccgtgcttatctt
cagtgggtagacgagttgcacgatcgctaccatgacctcgtgattgaaaactgctccagc
ggggcccagcgaatggattacgccatgttggcggtccacgctcttcagtcgtcgagcgac
cagcaagatccagagcgctacccggccattgcctcggctctccctactgcagttactccg
gaacaaggagcaatatgggcttacccacagccggcatgggatggtgagctcaacgcgatg
accgtagtcaatagtcttcttggcagagtgcatttaagtggtcgtttagatcttctccgg
ccggagcagattgatctgatcaaagagggcatggacgtttatagagccatccgggctgat
ttgcccacagcaaccgccttttggcctttgggtcttccgcaatggcatgatgattggttc
tcactcggtatggatgtgacgaagcctgagggcaatggtcgccagtgctattacctttca
atttggagacgaggcggtcccgaatccattgacctgcccgtcaaagccctgtgtggtagg
gctgttagcactgagatcctttaccctaccagtcttcctgcgaaggctgtatggttgtct
aacaaaggtttattggaagtcactattccgtctgcaatgggagctcgacttatcaagctg
acagcagagtga

DBGET integrated database retrieval system