KEGG   Aspergillus fumigatus: AFUA_8G01130Help
Entry
AFUA_8G01130      CDS       T01017                                 

Definition
alpha-galactosidase C (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
afm  Aspergillus fumigatus
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:afm00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:afm00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:afm00600]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:afm00603]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 728 aa AA seqDB search
MAQKSTTANAIVVEGKTFALNGYNVSYRFHVDESTGDLRSDHFGGSVSGPIPDDSAPIMN
GWTGMPDRVRREFPDQGRGDFRIPAIRIRQSQGHTVSAFRYDSHTVLKGKPALAGLPATF
GTEEDVSTLVVHLYDQHSEVAADLMYSIFPKHDAIVRSVRITNKGEGTISIEALSSMSVD
LPCEDFDMIGLRGDWAREAHRRRRKVDYGIQGFGSTTGFSSHLHNPFVALAHRSTTESHG
EAWGFSLVYTGSFAANIEKGSQGLTRVSMGFHPNQLSWPLAPGEIFTSPECVSVYSKDGL
GGMSRSLHRLYRNHLMKSKFAADNRPVLLNSWEGLYFDINEENMHRMAQESAALGVKLFV
MDDGWFGDKYPRVSDSAGLGDWVPNPTRFPNGLAPLVKAITSLKVAKSPENLRFGIWVEP
EMVNPQSSLYHEHPDWVLHAGSYPRTEQRNQLVLNLALPEVQEFIIDAITNILNSADISY
VKWDHNRAINETPSPAATHAYMLGMYRVFDTLTSRFPDILWEGCASGGGRFDPGVLQYFP
QIWTSDDTDAVERIFIQMGTSLVYPASAMGAHISAVPNHQTGRTVPLTFRAHVAMMGGSF
GLELDPLKMCPEEKAVVPELIALAEKVNPIVLKGDMWRLSLPEESNWPAVLFVSEDGVKA
ILFLFQLSPNVNHTIPRVRLQGLDRQAMYSVDEQGPYSGDMLMNLGLQYSFSTDYASKVV
FLERVDVM
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagaaatcgaccactgccaacgccattgtcgtcgaaggcaaaaccttcgccctt
aatggctacaatgtttcctaccggttccacgttgacgagagcaccggtgacttgcgctcc
gatcacttcggcggcagcgtcagtggacctattcccgatgattcagctcccataatgaat
gggtggaccggtatgcctgaccgcgttcgccgcgagttcccggaccaaggccggggagat
tttcgaatccctgccattcgcatccgccagtcgcagggacatactgtttcagcttttcgg
tatgattcgcataccgtgttgaagggcaagcctgcgctggctggcttgccagcaacgttt
ggcacagaggaggatgtctcgacgctggtggtgcatttgtatgaccaacatagcgaggtg
gcggcggatctaatgtactccatattcccaaagcacgatgccattgtccggagtgtgcgc
atcacgaacaagggggagggcacaatctcaattgaggcgctgtctagtatgagtgtggat
ttaccatgcgaggactttgatatgattggcctcagaggggactgggcaagagaagcgcat
cggcggaggcgcaaggtggactatggaatacagggatttgggagtacaacaggcttctcg
tcccacttgcacaaccccttcgtcgccctggcgcatcgctctactaccgagtcccacggt
gaggcatggggattctcactggtctacaccggctcctttgctgccaatattgaaaaaggc
tcgcagggattgacacgtgtatccatgggtttccatccaaaccagctatcctggcccttg
gctccgggggaaatcttcacgtctcccgagtgcgtatcggtatattcaaaagacggtcta
ggaggcatgtcgcgctctctgcatcgcctgtaccgcaatcacctgatgaaaagcaagttt
gctgcggacaaccgacccgtcttactgaacagctgggaggggttgtatttcgacatcaac
gaggagaacatgcaccgcatggcacaggaatccgctgctttgggtgtaaagctcttcgtc
atggacgacgggtggtttggcgacaaataccctcgcgtctccgactcagcgggtctaggc
gactgggttcccaacccaacccgatttcctaatgggctcgcgccgctcgtgaaagccatt
acctccttgaaggtcgccaagtcgccagaaaaccttcgctttggtatctgggttgagccg
gagatggtaaacccacagtcaagcctataccacgaacacccggactgggtcctccacgca
ggctcatacccacgcaccgaacaacgcaaccagctcgtcctgaatctcgcgctacccgaa
gtacaagagtttatcatcgacgccatcaccaacatcctcaacagcgcagacatcagctat
gtaaaatgggaccacaaccgtgctatcaacgagacgccctcccccgccgcaactcacgca
tacatgcttggaatgtaccgcgtcttcgacaccctcacctctcgcttccccgatatcctc
tgggaaggatgcgcctccggcggtggacgctttgaccctggagtcctacagtacttcccc
cagatctggacatcagatgacaccgacgccgtggaacgcatcttcatccagatgggtacg
tcactcgtctaccccgccagcgcaatgggcgcgcatatctccgcggtgccgaaccaccaa
acagggcgaacggtgccgcttaccttccgcgcgcacgttgcaatgatgggcggatcgttc
gggcttgagctcgatccactgaagatgtgtcctgaggagaaagctgtggttcccgagctg
atcgcgttggcggagaaggtcaacccgatcgtgctgaaaggcgatatgtggaggcttagt
ctgcccgaggagtcgaattggcctgctgtgttgtttgtctcggaagatggagtcaaagct
atcctgttcctcttccagctgagcccgaatgttaatcataccatacccagggtgagattg
caggggctggacaggcaggcgatgtacagcgttgacgagcaggggccgtattcgggtgat
atgctgatgaaccttggattgcagtattcatttagcactgattacgctagcaaagtggtg
tttttggaaagggtcgatgtgatgtga

DBGET integrated database retrieval system