KEGG   Aspergillus fumigatus: AFUA_8G04060Help
Entry
AFUA_8G04060      CDS       T01017                                 

Definition
beta-N-acetylglucosaminidase (EC:3.2.1.-)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
afm  Aspergillus fumigatus
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AFUA_8G04060
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    AFUA_8G04060
Enzymes [BR:afm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     AFUA_8G04060
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 931 aa AA seqDB search
MAPKEDTLPPGWEDLDRQMGQLFMMGFDGTSVNPQIRSLIENYHLGSVLLTAKNLKSAEE
ATRLVLELQTIARDAGHPVPLLIALDQENGGVNSLYDEIYIRQFPSAMGIAATGSKSLAH
DVAYATAQELKAVGVNWILGPVLDVLTNVRTQPLGVRTTGDDPQEVSQYGVEFMKGYKKA
GLVTCGKHFPSYGNLEFLGSQTDVPIITESLEQLSLTALVPFRNAIVHGLDSMMVGGVSM
SSAGVNVMHACLSEQVVDDLLRKDLKFNGVVVSECLEMEALTHNIGVGGGTVMAKNAGCD
IILLCRSFPVQQEAINGLKLGVENGIIGRARIEQSLRRVLKMKAKCTSWDQALNPPGLPS
LMQMQPSHTSLSKRAYNNSISVVRDKQNLLPLSNIIEPNEELLLLTPLVKPLPASAVSRS
VTEHMNLSIDPIASDRTASVLSGESVFKELGRSLSRQRSGRVLHTSYTANGVRPIHENLI
DRASAVIVVTADANRNLYQHGFTKHVSLICRSQFSPSGEPREKPMIVIAASSPYDFAMDT
SIGTYVCTYDFTETALEALVKVLYGELTPKGSLPGSISRSQKLHQARQHWLVENWNEERD
AQSLDTLLDAVRADCAQGQRSELLGVTSSSFLLRSEEIDEAHFVVRNSSTQALYGFCSTY
FFRSTGTGVIGSLIVDPARRKLSIGNSLHNRAIRTLLQRKGMRRFQLGSRLPGIYLGIPS
SNPVERKRLRQWFANLGWNTALSRPVCSVVLRNLPTWTPPDGLIQGLKNADVSYDLVHGW
DYAEPILDHIKTNSRQGLIDIYKIALGGAPNCGIIRATRPSDGAILGTVVIYNGRSSLAE
HMPVLKATQPSSGGISSPVISPSVGEYATVMQGLVLLGIKQIRRQGAEAVVIDCVDGDSN
FDCLSGMGFSMLHSFEEVNCDAATWTMMPTT
NT seq 2796 nt NT seq  +upstreamnt  +downstreamnt
atggccccaaaagaggatacgctgccccctggctgggaggatctagacagacagatgggg
cagctcttcatgatgggcttcgatgggacgtcagtcaatccccaaattcgctctcttatc
gagaattaccatctgggctcagttctgttgacagccaagaacttaaaatctgcagaagag
gcaacgcgactggtgcttgagttacaaacaatcgcccgagatgctggccatcctgtgcct
ttacttattgccttggaccaggaaaatggcggtgtgaatagcctgtacgatgaaatctac
attcgacagttccccagcgcaatgggaatcgcagcaactggctcaaagtcactggctcat
gatgtcgcatatgctacagcccaagagctgaaagccgtaggggtcaactggatccttggc
cctgtactagacgttttgactaacgtacgaacccagccgctgggggttcgcactaccggc
gatgatccccaggaggtgtcgcaatatggcgttgagtttatgaaaggctacaaaaaagca
ggattggtgacatgtggcaaacactttccgtcctatggtaacctcgaatttcttgggtct
caaacagacgttcccatcatcaccgagtcgctggagcagctcagcttaacagcgctggtc
ccattccgcaatgccatagtccacggtttagattcgatgatggtgggaggtgtctcaatg
tcgtctgccggtgtgaacgtcatgcatgcttgtttgagtgagcaggttgttgatgacttg
ctgcggaaagatttgaaattcaatggtgtggtggtttctgagtgcttggagatggaggct
ctcactcataatatcggtgtcggcggcggaacagtgatggcgaagaatgcgggctgtgat
ataatcctcttgtgtagatcctttccggtgcaacaggaggcgatcaatggtttgaagctc
ggggtggagaacggcatcattggtcgggctcgcatagagcaatctttgcgccgggttttg
aaaatgaaggcgaaatgcacctcttgggaccaagccctgaaccctccggggctgccatct
ctaatgcagatgcaaccatctcataccagcctctccaaaagggcatacaacaactctatt
tcagttgtacgtgataagcagaatttgcttccgctgtccaacatcattgagcctaatgag
gaattgctacttttgactccgcttgtcaagccactgcccgcatctgcagtctctcgttcg
gtgacggagcacatgaatctttctatcgacccgattgcttcagatagaaccgcctctgtg
ctgagcggtgagagtgttttcaaggaactgggtcgttctctctcacgtcaaagaagtggt
cgtgttctacatacatcttacacggccaatggcgtccgaccaatccacgagaatttaata
gatcgggctagtgccgtcattgtcgtcactgccgatgcaaacaggaacttgtaccagcat
ggcttcacgaaacatgtctctctaatctgtaggtctcagttttctccatcgggcgagccg
cgagagaagcctatgatcgtcatcgccgctagttccccatatgattttgccatggatacg
tccattggtacctatgtctgcacttacgatttcacagagaccgctttggaggcgttggtc
aaagttctctacggagaattgacaccaaaaggctcattgccgggttctatcagccgcagc
cagaagctccatcaagcgcggcagcactggcttgtagaaaactggaatgaagagagagat
gcccagtccttggatactttactggatgcagtcagagcggattgcgcgcagggtcagcgt
tctgagctgctaggtgtgacatccagcagctttttattacgaagcgaagagattgatgag
gcgcactttgttgtacgaaacagcagtacgcaggctttgtacggattctgctcgacttat
ttctttaggtcgacgggcacaggcgttattggatctttgattgttgatcctgcaagacgg
aaattatctatcgggaactcactgcacaaccgcgcaatccgaacacttcttcagcgaaag
ggaatgaggaggtttcagctaggttctcgactcccaggcatatacttaggcattccgtct
tcgaatccagtggagcgtaagaggttacgccagtggtttgccaaccttggctggaacact
gccctttcgcggccggtttgcagtgtggtgctgcggaatcttccaacatggacgccgcct
gatggcctcatacaggggttgaaaaatgccgacgtctcctacgatcttgttcatgggtgg
gattacgcggagcctatccttgatcacatcaagacgaattctcgacaaggacttattgat
atatacaagatcgctttgggaggagcaccaaactgtggcataatacgggccacgcggccg
agcgatggagcaattctgggtaccgtggtgatatacaacggacggtcgtcattggcagag
cacatgcctgtgctgaaagccacacaaccgtcgagcggaggcatatcgtctccagtaatt
tctccgtctgttggcgagtatgctacggtgatgcaggggctcgtattactgggcatcaaa
caaattcggagacaaggcgcagaggctgttgtcattgactgcgttgatggcgacagcaat
ttcgattgcctgtctggaatgggcttcagcatgctgcatagcttcgaggaagtgaactgc
gatgcagcaacctggaccatgatgccaacgacgtga

DBGET integrated database retrieval system