KEGG   Aspergillus fumigatus: AFUA_8G04500Help
Entry
AFUA_8G04500      CDS       T01017                                 

Definition
mannosyltransferase PMTI
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
afm  Aspergillus fumigatus
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    AFUA_8G04500
Enzymes [BR:afm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     AFUA_8G04500
Glycosyltransferases [BR:afm01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   AFUA_8G04500
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 780 aa AA seqDB search
MSSSPSSSLRKRGGRKEAYSPLPSDDASSPLSSSKPSVASTNQSGWDYRLALVVLTILAF
ITRFYKISYPNEVVFDEVHFGKFASYYLQRTYFFDVHPPFGKLLFAFMGWLIGYDGHFLF
DNIGDSYIDNKVPYVALRAMPATLGALTIPVVFLIMWESGYSLPACVLAAGLVLFDNAHV
GEDRLILLDASLVLSMALSILCYVRFYKLRHEPFGRKWWKWLLLTGVSLSCVISTKYVGV
FTFVTIGAAVLVDLWNLLDINRPSGALSMAHWTKHFAARAFALIIVPFFFYLFWFQVHFA
ILTRSGPGDDFMTPEFQETLSDNLMSAQSIGIQYYDTITIRHKDTKVFLHSHWEKYPLRY
DDGRISSQGQQVTGYPFNDTNNHWQILPSVPYPETDRQGHSVKNGDIVQLRHVGTDTILL
THDVASPYYPTNQEFTTVSHELANGERHNDTLFEIKIENGKPQQEFRSLSSHFKLIHVPT
RVAMWTHTTPLPEWAFKQAEINGNKNILQTSNLWFVDTIESLEENSPRAIKKERQVKHLP
FWRKYLELQRAMFFHNNALTSSHPYASEPFQWPFLLRGVSFWTKNDTREQIYFLGNPIGW
WIASSLLAVFVGVIGADQLSLRRGVDALEEIWGRGARSRLYNSTAFLFLCWAAHYFPFWL
MGRQRFLHHYLPAHVASCMVAGALIEFIFNLQPISVARAVKEDDPTGKSKAHGSAGHFVT
AKERMGRQSLIAGWVATLVILSLTIWGFCFFAPLTYGTPGLDVAGVNARKWLGYDLHFAK
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcatctccttcgtcctctcttcgcaagagaggcgggagaaaggaggcctactct
ccattgccttcggacgatgcctcctctcctttgtcttcatccaagccgagcgtggcttcc
acgaaccagtcgggatgggactataggctggccttagtcgttctcaccatcctggctttc
atcacccggttctataagatatcctaccctaatgaagtggtatttgacgaggtgcatttt
ggcaagttcgcttcgtactacttacaaagaacttatttcttcgatgtgcaccctccattt
ggcaaattgctcttcgctttcatggggtggctgattggctacgatggccactttttgttc
gacaacatcggcgactcctatatcgataacaaagttccttatgtcgctctccgcgcaatg
ccggccactctgggggctctgaccatccctgtggtcttcctcatcatgtgggaatccgga
tattcgttgccggcctgcgtgttggctgccggtctcgtactgtttgacaatgcccacgtc
ggagaggacagactgattctgctggatgcctccttggtactatccatggcactaagcatc
ctgtgctacgttcgcttctacaagctgcgtcatgaaccctttggccgtaaatggtggaag
tggctgctcttgacgggcgttagtctcagctgcgttatctctacgaagtatgtcggtgtt
ttcacatttgtcaccattggtgctgcggttttggttgacctgtggaacttgttggatatc
aaccgcccatcgggagctctcagcatggcccattggactaagcactttgctgcccgcgca
tttgccctcatcattgtgcctttcttcttttacctgttctggttccaggtccatttcgcc
attctcacccgctccgggccaggcgatgatttcatgaccccggagttccaggaaaccctc
agtgacaacctcatgtcggcgcagtcgatcggcattcagtactatgacacaatcactatc
aggcacaaggacaccaaggtgtttcttcacagccactgggagaagtatcccctccgctat
gatgacggccgtatttccagccagggccagcaggtcacaggatacccattcaacgacacg
aacaatcactggcagattctgccttctgttccctatcctgaaaccgacaggcaaggccac
agtgtcaagaacggcgacatcgtccagctccgtcacgtcggtactgacaccatcctgctg
acgcacgatgttgcgtcgccttattatcctaccaaccaggagttcaccaccgtttctcat
gaattggccaatggtgagcgacacaacgatacgctgttcgagatcaagatcgagaacggc
aagcctcaacaggaattccgctctctctcaagccatttcaagctgatccatgtgcccact
cgcgtcgcgatgtggacccatacaaccccccttcctgagtgggcctttaagcaagccgag
atcaacggcaacaaaaatatccttcagacgagcaatctttggttcgtggacacaatcgag
tcgttggaagaaaacagcccccgtgctataaagaaagagcgccaggtcaaacatctcccc
ttctggcgcaagtaccttgagctgcaacgggctatgttcttccataacaatgctctgacc
agcagccatccgtacgccagcgagcccttccagtggcccttcctactccgaggtgtcagc
ttctggaccaaaaatgacaccagagagcagatttatttcctgggtaatcctatcgggtgg
tggattgccagcagtctgttggctgtctttgtcggggtcatcggcgctgatcagctgtcc
cttcgccgcggagtcgacgctcttgaagaaatttggggccgtggcgctcgttctcgtctg
tacaacagcactgccttcttgttcctttgctgggctgcccactacttccccttctggctg
atgggtcgccagcgtttcctccaccattaccttccggctcacgtcgcgtcttgtatggtc
gcaggagccctgatcgaattcattttcaatttgcagccgatctccgtggctagagctgta
aaggaagatgatccgactggcaagtccaaggcccatggtagcgccggtcattttgtcacg
gcgaaggaacgaatgggtcgccagtcgctcattgctggatgggttgcgaccctggtcatt
ctgagtttgacgatctggggattctgcttctttgcgcccctgacatacggtacccctggt
ttggatgttgcaggcgtcaatgcacggaaatggctgggctatgacctgcatttcgccaaa
taa

DBGET integrated database retrieval system