KEGG   Aspergillus fumigatus: AFUA_8G05020Help
Entry
AFUA_8G05020      CDS       T01017                                 

Definition
beta-N-acetylhexosaminidase NagA (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
afm  Aspergillus fumigatus
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AFUA_8G05020
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    AFUA_8G05020
   00603 Glycosphingolipid biosynthesis - globo series
    AFUA_8G05020
   00604 Glycosphingolipid biosynthesis - ganglio series
    AFUA_8G05020
   00511 Other glycan degradation
    AFUA_8G05020
Enzymes [BR:afm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     AFUA_8G05020
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 600 aa AA seqDB search
MLISSICAVVLTVASSVAAVSVNPLPAPRNITWASSGPKRLAGHLTLRTDRGSNSQIIWQ
GWDRAWKTIVSLQWVPAATEAPISSFEPFPTATPSSSKSKRAPSSLQFVNVKVEDPKADL
QHGVDESYTLDVKEGSDTIQITAKTVWGALHAFTTLQQIIISDGKGGLIIEQPVSIQDAP
LYPYRGIMIDTGRNFISVKKILEQLDAMSLSKLNVLHWHLDDTQSWPVQINAHPEMVKDA
YSVRETYSHADIRQIIAYARARGIRVIPEVDMPSHSSSGWKQADPKMVTCADSWWSNDVW
QYHTAVQPNPGQLDIIYDKTYDIVRDVYNELSGVFTDNWFHVGADEIQPNCFNFSTYVQS
WFAEDPSRTYNDLSQYWVDHAVPIFRNVSEKRRLIMWEDIVLSPEHAHDVPKDIVMQTWN
NGVEYIQNLTARGYDVIVSSADFFYLDCGSGGYVTNDPRYNVLSNPDPSTPNFNYGGNGG
SWCAPYKTWQRIYDYDFTTNLTDAQAKHIIGATAPLWSEQVDDVTVSSKFWPRAAALAEL
VWSGNRDANGKKRTTLMTQRILNFREYLLANGIQAGNLVPKYCLQHPHACDLYYDQSAVA
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgctcatctccagcatctgcgccgtagtccttacggtcgcctcgtcggtcgccgctgtc
agcgtcaatcctctgccggctcctcgcaatatcacttgggcgtcatcggggcccaaacgc
cttgcgggtcatctcactctgcgtacagaccgcggctccaacagccagatcatttggcaa
ggatgggatcgcgcctggaagacgatcgtctcgcttcaatgggttcccgctgcgactgag
gcgccgatctcctccttcgagccgttccccaccgctacgccttcttcctcgaagagcaaa
cgtgccccgtcctcgctacaattcgtcaatgtgaaggttgaagatcccaaagccgatctc
cagcacggtgtggacgaatcttacaccttggatgtgaaggaaggctccgataccatccaa
atcactgcaaagaccgtttggggtgctctgcatgcgttcaccacccttcagcagatcatc
atctcggatgggaaaggtggactaatcatcgagcaacctgtcagtatccaggatgcgcct
ctctatccttatcgtggcatcatgatcgatactggtcgcaatttcatctccgtgaaaaag
atcctggagcagttggatgccatgtcattgtccaagctgaatgtcctgcactggcacttg
gatgacacgcaatcgtggcctgtacagatcaacgcacatccggagatggttaaagatgca
tactcggtccgagagacttactcgcacgctgacatccgccaaattattgcctatgcccgt
gcccgaggtatccgtgtcatccccgaagtcgatatgcccagtcactcgtcgtctggttgg
aagcaggcagacccgaaaatggtgacttgcgccgattcctggtggtccaacgacgtctgg
caatatcatactgccgttcaacccaacccgggccagctggacatcatctacgacaagacg
tacgacatcgttcgggatgtctacaatgagctgtcgggggtctttaccgacaattggttc
catgtgggagctgatgagattcaacccaattgcttcaatttcagtacctatgtccagtca
tggttcgcagaagatccgtcgcgcacctacaacgatctgtctcagtactgggtggatcat
gcagttcccatcttccgcaacgtcagcgagaagcgccgtctgatcatgtgggaggatatc
gttctctctccagagcacgctcacgacgtacccaaggacattgtcatgcagacctggaac
aacggggtggaatacatccagaatctgacggcccggggctacgatgttattgtatcgtcc
gccgactttttctatcttgactgtggctctggcggatacgtcacaaacgaccccaggtac
aacgtcctgagcaatccggatcccagcacaccaaacttcaactatggcggcaatggagga
tcatggtgcgctccttacaaaacatggcagcggatctacgactacgacttcacgacaaat
ctgacggatgctcaagccaagcatatcatcggtgcgaccgcgcctctctggagcgagcag
gtggatgatgtaactgtgtcgagcaagttctggccccgcgccgcagccctggccgagctg
gtctggtctggcaaccgcgatgccaatggaaagaagcggactacgctcatgacgcagcgt
atcctcaacttccgagagtacttgctcgcgaacggcatccaggccggcaacctggtgccg
aagtactgtcttcagcacccgcacgcgtgcgatctatactatgaccaaagtgccgtcgcg
tag

DBGET integrated database retrieval system