KEGG   Aspergillus fumigatus: AFUA_8G06880Help
Entry
AFUA_8G06880      CDS       T01017                                 

Definition
pectin methylesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
afm  Aspergillus fumigatus
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Module
Pectin degradation
Brite
KEGG Orthology (KO) [BR:afm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AFUA_8G06880
   00500 Starch and sucrose metabolism
    AFUA_8G06880
Enzymes [BR:afm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     AFUA_8G06880
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 324 aa AA seqDB search
MYLPSLVLGLLGFGLTASTSPIEERSNRSKAPAGCLTVGSSGTYATIGAALSALGSSTSD
ACIFIGAGTYQEQITIDYKGKLTMYGETTDTSSYKQNLVTITHSISSPEAGSLDKSATVN
VRSDGFKMYNINVINGYGKGAQAVTLVANADKLGFYGCSFVGYQDTLYAKAGRQYYSNCY
IEGAVDYIFGDASAWFGECDLVSVGPGYITAMSRTTADETTWYAIDHCNIYGKPGVDLTS
AVYLGRPWRVLARVIFQNSQLSNIINPKGWSPMATGATPLYYEYNNKGAGADTSKREYES
PISGAVSIATVLGGGWNSWVDTTY
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgtatcttccctctctcgtcctcggccttcttggctttggcctcacggcttctacaagc
cccatcgaagaacggtcgaatcgcagtaaagccccagccggatgccttacagtcggctca
tcgggtacgtacgcgaccattggcgctgcgttgagcgctctcggcagctccacgtccgac
gcctgcatcttcattggtgctggaacgtaccaggagcagatcaccatcgactacaagggc
aaactcaccatgtacggcgagacgaccgacacgagttcatacaagcagaacctggtcact
atcacccatagcatttcctctcctgaggcgggatcgcttgacaagagcgccacggtcaat
gtccggtcggacgggttcaagatgtataacatcaatgttatcaacggttacggcaagggc
gcacaggctgttacgctcgtcgccaatgccgacaaacttggcttctacggatgcagtttt
gtcggctaccaagacactctctacgccaaggccggtcgtcaatactactctaactgctac
atcgagggagccgttgactacatcttcggtgacgcctcggcctggttcggcgaatgcgac
ctcgtgtccgtcggccccggctacattaccgccatgtcgcgcacgacggcggacgagacc
acctggtacgcgatcgaccactgcaacatctacgggaagcccggcgtcgatcttaccagc
gcggtgtaccttggtcggccttggcgtgtgcttgcccgtgtcatcttccaaaattcccag
ttgtcgaacatcatcaaccccaagggctggagccccatggcaacgggggccacaccgctc
tactatgagtacaataacaagggtgctggagcggatacctcgaagagagagtacgagtct
cccatctctggtgctgttagcatcgccacggttcttggcggcggttggaacagctgggtt
gataccacgtattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system