KEGG   Aspergillus fumigatus: AFUA_8G07120Help
Entry
AFUA_8G07120      CDS       T01017                                 

Definition
(RefSeq) beta-1,6-glucanase Neg1
  KO
K22276  
glucan endo-1,6-beta-glucosidase [EC:3.2.1.75]
Organism
afm  Aspergillus fumigatus
Brite
Enzymes [BR:afm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.75  glucan endo-1,6-beta-glucosidase
     AFUA_8G07120
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
8
AA seq 488 aa AA seqDB search
MRISVGALLGLTALSHATTEKRAASASAYCSNSAGNYKLSSIAAPVQGAGNPGSESTWQL
TVDDTSSGHKQTIVGFGAAVTDATVTSFNTLSASVLQDLLNKLMTPAGANFALMRHTIGA
SDLSGDPAYTYDDNGGKADPSLSGFNLGDRGTAMAKMLATMKSLQPNLKILGSPWSAPGW
MKLNGVLDGNTNNNNLNDGYLTSGGTGSTGYASQFAQYFVKYIQAYKNLGAHVDAITIQN
EPLFSSAGYPTMYVYDYESAQLIQNYIGPALASAGLDTEIWAYDHNTDVPSYPQTVLNQA
GQYVKSVAWHCYAPNVDWTVLSQFHNTNPGVKQYMTECWTPASGAWHQAADFTMGPLQNW
ASGVAAWTLGTNAQDGPHLSTGGCATCQGLVTINNGGYTLNTAYYMMAQFSKFMPPGAIV
LNGSGSYTYSGGGGIQSVASLNPDGTRTVVIENTFGNDVYVTVTMKSGQKWSGNAPSQSV
TTWVLPSA
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatatctgtcggtgctctgcttggcttgacagccctgagtcatgccacaacagag
aaacgagccgcctctgcttcggcttactgttccaactcggccggcaactacaagctgtcc
tccatcgcagctccggttcaaggggccggaaaccccggctcggaatcgacctggcaattg
accgttgacgacacttcgtccggtcacaaacagacgatagttgggttcggtgctgctgtc
actgatgccacggtcacctcgttcaacactttgtccgcctccgtgctgcaagacttgctc
aataaactgatgacacctgccggggcgaactttgctttgatgcgacatactattggggct
tcggatctgtccggtgacccagcctacacgtacgatgacaatggtgggaaagcggatccg
tcactgtcgggattcaacctgggggaccgcggaacggctatggccaagatgttggcaaca
atgaagtctctgcagcccaacctcaagatcctcggctctccctggagtgcaccaggatgg
atgaagctgaacggggtccttgatggcaatacgaacaacaacaacttgaacgatggatac
ctaaccagtgggggaaccggtagtacggggtatgccagtcaattcgcgcagtactttgtc
aagtacattcaggcctataagaatctcggtgctcacgtcgacgcgattaccatccagaac
gagccgctgttcagctcagcgggctatcccaccatgtatgtctacgattatgagtcggca
cagctgatccagaactacatcggccccgctcttgccagcgcggggctagatacggaaatc
tgggcttatgaccacaacacagatgtcccgtcgtacccccagactgtccttaaccaggcc
ggtcagtacgtcaagtcggtggcctggcactgctacgctcccaacgtcgactggaccgtg
ctcagccagttccacaacacaaaccctggagtgaagcaatatatgaccgagtgctggact
ccagcatctggcgcatggcatcaggcggcggacttcaccatgggtcccctgcagaactgg
gcctcgggagtggcagcatggactctgggaaccaacgctcaggatggtccgcatctgtcc
actggcggctgcgcgacatgtcaaggcttggtgaccatcaacaacggaggatacacgctc
aacaccgcatactacatgatggcgcaattcagcaagttcatgccgcctggtgcgattgtg
ctcaatggcagtggcagctacacgtactctggcggaggcggtatccagtccgtggcttcc
ttgaatcccgatggaacccgcactgtggttattgaaaacacttttggcaatgatgtctat
gtgactgtcactatgaagagcgggcagaagtggagtgggaacgcccctagccaatccgtg
actacctgggttcttccatctgcttga

DBGET integrated database retrieval system