KEGG   Aspergillus fumigatus: AFUA_8G07120Help
Entry
AFUA_8G07120      CDS       T01017                                 

Definition
beta-1,6-glucanase Neg1 (EC:3.2.1.-)
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
afm  Aspergillus fumigatus
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:afm00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:afm00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 488 aa AA seqDB search
MRISVGALLGLTALSHATTEKRAASASAYCSNSAGNYKLSSIAAPVQGAGNPGSESTWQL
TVDDTSSGHKQTIVGFGAAVTDATVTSFNTLSASVLQDLLNKLMTPAGANFALMRHTIGA
SDLSGDPAYTYDDNGGKADPSLSGFNLGDRGTAMAKMLATMKSLQPNLKILGSPWSAPGW
MKLNGVLDGNTNNNNLNDGYLTSGGTGSTGYASQFAQYFVKYIQAYKNLGAHVDAITIQN
EPLFSSAGYPTMYVYDYESAQLIQNYIGPALASAGLDTEIWAYDHNTDVPSYPQTVLNQA
GQYVKSVAWHCYAPNVDWTVLSQFHNTNPGVKQYMTECWTPASGAWHQAADFTMGPLQNW
ASGVAAWTLGTNAQDGPHLSTGGCATCQGLVTINNGGYTLNTAYYMMAQFSKFMPPGAIV
LNGSGSYTYSGGGGIQSVASLNPDGTRTVVIENTFGNDVYVTVTMKSGQKWSGNAPSQSV
TTWVLPSA
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgcgtatatctgtcggtgctctgcttggcttgacagccctgagtcatgccacaacagag
aaacgagccgcctctgcttcggcttactgttccaactcggccggcaactacaagctgtcc
tccatcgcagctccggttcaaggggccggaaaccccggctcggaatcgacctggcaattg
accgttgacgacacttcgtccggtcacaaacagacgatagttgggttcggtgctgctgtc
actgatgccacggtcacctcgttcaacactttgtccgcctccgtgctgcaagacttgctc
aataaactgatgacacctgccggggcgaactttgctttgatgcgacatactattggggct
tcggatctgtccggtgacccagcctacacgtacgatgacaatggtgggaaagcggatccg
tcactgtcgggattcaacctgggggaccgcggaacggctatggccaagatgttggcaaca
atgaagtctctgcagcccaacctcaagatcctcggctctccctggagtgcaccaggatgg
atgaagctgaacggggtccttgatggcaatacgaacaacaacaacttgaacgatggatac
ctaaccagtgggggaaccggtagtacggggtatgccagtcaattcgcgcagtactttgtc
aagtacattcaggcctataagaatctcggtgctcacgtcgacgcgattaccatccagaac
gagccgctgttcagctcagcgggctatcccaccatgtatgtctacgattatgagtcggca
cagctgatccagaactacatcggccccgctcttgccagcgcggggctagatacggaaatc
tgggcttatgaccacaacacagatgtcccgtcgtacccccagactgtccttaaccaggcc
ggtcagtacgtcaagtcggtggcctggcactgctacgctcccaacgtcgactggaccgtg
ctcagccagttccacaacacaaaccctggagtgaagcaatatatgaccgagtgctggact
ccagcatctggcgcatggcatcaggcggcggacttcaccatgggtcccctgcagaactgg
gcctcgggagtggcagcatggactctgggaaccaacgctcaggatggtccgcatctgtcc
actggcggctgcgcgacatgtcaaggcttggtgaccatcaacaacggaggatacacgctc
aacaccgcatactacatgatggcgcaattcagcaagttcatgccgcctggtgcgattgtg
ctcaatggcagtggcagctacacgtactctggcggaggcggtatccagtccgtggcttcc
ttgaatcccgatggaacccgcactgtggttattgaaaacacttttggcaatgatgtctat
gtgactgtcactatgaagagcgggcagaagtggagtgggaacgcccctagccaatccgtg
actacctgggttcttccatctgcttga

DBGET integrated database retrieval system