KEGG   Acidaminococcus fermentans: Acfer_0049Help
Entry
Acfer_0049        CDS       T01151                                 

Definition
(GenBank) Glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
afn  Acidaminococcus fermentans
Pathway
afn00220  Arginine biosynthesis
afn00250  Alanine, aspartate and glutamate metabolism
afn00471  D-Glutamine and D-glutamate metabolism
afn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:afn00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Acfer_0049
   00220 Arginine biosynthesis
    Acfer_0049
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Acfer_0049
Enzymes [BR:afn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Acfer_0049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: ADB46458
JGI: Acfer_0049
UniProt: D2RN32
Position
complement(66408..67349)
Genome map
AA seq 313 aa AA seqDB search
MVMDKEEIQRILEKALEEGRNVLYEGRVASYIPELAKANSGNLGVCLMRKDGTEYSAGDC
NIPFTMQSISKTFSLILALQTAGYDKVFSKIGMEPTGDRFDSILQLELKDWRPFNPMINA
GAIVTASCIESPDPFQSFLDLVRRLCANPRISLNESVYRSEKKTGTRNRSIAYLLKSDNV
LDGEPEEVLDVYFRMCSVMVTARDLAHYGMILSNHGVDPQTGEQLVDSTIVRIVTTLMML
CGMYDESGEYAVKVGMPSKSGVGGGICAIARHGIGIGTFGPMLNKKGNSVGGERILRILS
ESLGLHVFDTKEF
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggtcatggacaaagaagagatccagcggatcctggaaaaagccctggaagaaggcagg
aatgtcctgtacgaaggcagggtggccagctacatcccggaactggccaaagccaattcc
gggaacctgggggtctgccttatgcggaaggacgggacggaatactccgccggggactgc
aacatcccctttaccatgcagagcatctccaagaccttctccctgatcctggccctccag
actgccggctatgacaaggtattcagcaagatcggcatggaacccaccggggaccggttc
gacagcatcctgcagctggagctgaaggactggcggcccttcaatcccatgatcaacgcc
ggcgccatcgtgacagccagctgcattgaatccccggaccccttccagagtttcctggac
ctggtccggcggctctgcgccaatccccggatcagcctcaacgaatccgtctaccggtcc
gaaaaaaagaccggcacccgaaaccggtccattgcctacctgctgaaaagcgacaatgta
ctggatggggagccggaagaggtactggatgtgtacttccgcatgtgttccgtgatggtc
accgcccgggatctggcccattacgggatgatcctgtccaaccacggggtggatccccag
accggggagcagctggtggattccaccattgtccggatcgtcaccaccctgatgatgctc
tgcggcatgtacgatgaatcaggcgaatatgccgtcaaagtgggcatgcccagcaaaagc
ggcgtgggcggcggcatctgcgccattgcccgccacggtatcggcatcggcaccttcggc
cccatgctgaacaaaaaaggcaacagcgtgggcggggaacggatcctccggatcctctcc
gaatccctgggcctccacgtgttcgatacgaaggaattctaa

DBGET integrated database retrieval system