KEGG   Acidaminococcus fermentans: Acfer_0228Help
Entry
Acfer_0228        CDS       T01151                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
afn  Acidaminococcus fermentans
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:afn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Acfer_0228
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Acfer_0228
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Acfer_0228
Enzymes [BR:afn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Acfer_0228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
276206..277351
Genome map
AA seq 381 aa AA seqDB search
MHRGVDAMDRSKIAEVKRVVVKVGTSTITYPNGKINYEKIEKLARIMTDLQNQGKEMILV
SSGAGAAGVGRMGLEAKPASIPGKQACAAVGQGILMHIYERLFGEYGQVVAQVLLTKSDM
VNRHSYANARNALQEMISWGVIPIINENDVVAIDEFKIGDNDNLSALVASLADADLDILL
SDIDGLYTANPKTHPEARLVSVVEEVTPEIEATAGGAGSKNATGGMLTKLQAAKNAMSAG
IALIIANGEDLEILRKIMRGEPVGTLFVPRESHLRFRNQWLAFGSRISGKVIVDEGLAKA
LRQKGGCSILPVGITGVEGSFESGDTVSVLDQEGHELARGMTNYNAEDLDLIKGCRTSQI
EEKIGYKHYDEAIHRDNLVVL
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgcacagaggggttgatgccatggatcgcagtaaaattgcggaagtcaaacgcgtggtg
gtaaaagtcgggaccagtaccattacctatcccaacggaaagatcaactatgaaaagatc
gagaaactggcccggatcatgacggacctccagaaccaggggaaggaaatgatcctggtg
tcgtccggggccggggctgccggggtgggccggatgggcctggaggccaagccggcctcc
atcccggggaaacaggcctgtgccgccgtgggccagggcatcctgatgcatatctatgaa
cggcttttcggggaatacggccaggtggtggcccaggtgctgctgaccaagtcggatatg
gtgaaccggcacagctatgccaatgcccggaatgctctccaggaaatgatttcctggggg
gtgatccccatcatcaatgaaaatgatgtggtggccatcgacgagttcaaaatcggggac
aacgacaacctgtccgccctggtggccagcctggcggatgcggatctggacatcctgctg
tcggacatcgacgggctgtataccgccaatcccaagacccatccggaggccaggctggtt
tccgtggtggaggaagtgaccccggaaatcgaagccaccgccggaggcgccggttccaag
aacgccaccgggggcatgcttaccaagctccaggcggccaagaacgccatgagtgccggc
attgccctgatcattgccaatggggaagatctggagatcctccggaagatcatgaggggc
gaacctgtggggaccctgttcgtaccccgggaaagccatctccggttccggaaccagtgg
ctggccttcgggtccaggatcagcggcaaagtcattgtggatgagggactggccaaagcc
ctgcgtcagaaagggggctgcagcatcctgccggtgggcatcaccggggtggaaggcagc
ttcgaaagcggggacacggtgagcgtcctggatcaggagggccatgaactggcccggggc
atgaccaattacaatgcggaagacctggacctgatcaaaggctgccggaccagccagatc
gaagaaaaaatcggctacaaacattacgatgaagccatccaccgggacaacctggtggta
ctgtaa

DBGET integrated database retrieval system