KEGG   Acidaminococcus fermentans: Acfer_0228Help
Entry
Acfer_0228        CDS       T01151                                 

Definition
glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
afn  Acidaminococcus fermentans
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:afn01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:afn00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
276206..277351
Genome map
AA seq 381 aa AA seqDB search
MHRGVDAMDRSKIAEVKRVVVKVGTSTITYPNGKINYEKIEKLARIMTDLQNQGKEMILV
SSGAGAAGVGRMGLEAKPASIPGKQACAAVGQGILMHIYERLFGEYGQVVAQVLLTKSDM
VNRHSYANARNALQEMISWGVIPIINENDVVAIDEFKIGDNDNLSALVASLADADLDILL
SDIDGLYTANPKTHPEARLVSVVEEVTPEIEATAGGAGSKNATGGMLTKLQAAKNAMSAG
IALIIANGEDLEILRKIMRGEPVGTLFVPRESHLRFRNQWLAFGSRISGKVIVDEGLAKA
LRQKGGCSILPVGITGVEGSFESGDTVSVLDQEGHELARGMTNYNAEDLDLIKGCRTSQI
EEKIGYKHYDEAIHRDNLVVL
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgcacagaggggttgatgccatggatcgcagtaaaattgcggaagtcaaacgcgtggtg
gtaaaagtcgggaccagtaccattacctatcccaacggaaagatcaactatgaaaagatc
gagaaactggcccggatcatgacggacctccagaaccaggggaaggaaatgatcctggtg
tcgtccggggccggggctgccggggtgggccggatgggcctggaggccaagccggcctcc
atcccggggaaacaggcctgtgccgccgtgggccagggcatcctgatgcatatctatgaa
cggcttttcggggaatacggccaggtggtggcccaggtgctgctgaccaagtcggatatg
gtgaaccggcacagctatgccaatgcccggaatgctctccaggaaatgatttcctggggg
gtgatccccatcatcaatgaaaatgatgtggtggccatcgacgagttcaaaatcggggac
aacgacaacctgtccgccctggtggccagcctggcggatgcggatctggacatcctgctg
tcggacatcgacgggctgtataccgccaatcccaagacccatccggaggccaggctggtt
tccgtggtggaggaagtgaccccggaaatcgaagccaccgccggaggcgccggttccaag
aacgccaccgggggcatgcttaccaagctccaggcggccaagaacgccatgagtgccggc
attgccctgatcattgccaatggggaagatctggagatcctccggaagatcatgaggggc
gaacctgtggggaccctgttcgtaccccgggaaagccatctccggttccggaaccagtgg
ctggccttcgggtccaggatcagcggcaaagtcattgtggatgagggactggccaaagcc
ctgcgtcagaaagggggctgcagcatcctgccggtgggcatcaccggggtggaaggcagc
ttcgaaagcggggacacggtgagcgtcctggatcaggagggccatgaactggcccggggc
atgaccaattacaatgcggaagacctggacctgatcaaaggctgccggaccagccagatc
gaagaaaaaatcggctacaaacattacgatgaagccatccaccgggacaacctggtggta
ctgtaa

DBGET integrated database retrieval system