KEGG   Acidaminococcus fermentans: Acfer_0254Help
Entry
Acfer_0254        CDS       T01151                                 

Definition
phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
afn  Acidaminococcus fermentans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:afn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Acfer_0254
   01230 Biosynthesis of amino acids
    Acfer_0254
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acfer_0254
   00030 Pentose phosphate pathway
    Acfer_0254
   00051 Fructose and mannose metabolism
    Acfer_0254
   00052 Galactose metabolism
    Acfer_0254
  Energy metabolism
   00680 Methane metabolism
    Acfer_0254
Enzymes [BR:afn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Acfer_0254
Protein phosphatases and associated proteins [BR:afn01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Acfer_0254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
308920..310038
Genome map
AA seq 372 aa AA seqDB search
MQEKKRGTLAVLTGGGDCPGLNAVIRAVVKTALHHGFQIYGISNGFHGLICNDMKLMSLS
DVSGILPRGGTILGTTNRDNPFHYAAGEDEKGNVIYEDRRDVVVRNLKDHGIDCLIVIGG
DGSLKIAHDLHRFCDVNVVGVPKTIDNDLPCTERTFGFDTAMAMATEALDRLHTTAESHH
RVMVLEVMGRYAGWIALHSGIAGGADVILIPEIPYDLDAVIRKIHQRQQNGKKFSIITVA
EGAKPIGGQLTIARMVKESFEPIRLGGIGEKLAREIEERTGIESRCTVLGYLQRGGSPTA
YDRVLSTRYGAAAVEACLDEEYNVMVSLQANAIVRVPIAQAASKPHQVPVDSDIVRTGRE
LGISFGDEKPED
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaaaagaaaagagggaccctggcggtcctcaccggcggaggcgattgtcccggt
ctgaacgctgtgatccgggccgtggtcaagacggctctccatcacgggttccagatttac
ggcatttccaacgggttccatgggctgatctgcaatgacatgaagcttatgagcctgtcc
gatgtgtccgggatcctgccccggggcgggaccatcctggggaccaccaaccgggacaac
cccttccattatgctgcaggcgaagatgaaaagggcaatgtaatctatgaagaccggcgg
gatgtggtggtccggaacctgaaggaccacggcatcgattgtctgattgtcatcggtggg
gacggcagcctgaaaatcgcccatgatctccatcggttctgtgatgtgaacgtggtgggg
gtgcccaagaccatcgacaatgatctgccctgtacggaacggaccttcggctttgatacg
gccatggccatggccacggaagccctggaccggctccataccacggcggaatcccatcac
cgggtcatggtgctggaggtcatgggacggtatgcaggctggatcgccctccattccggc
attgcaggaggagcggacgtgatcctgatcccggaaattccctatgacctggatgcggtg
atccgcaagatccaccagcgccagcagaatgggaagaagttcagcatcattaccgtggcg
gaaggggccaagcccatcggagggcagctgaccatcgcccggatggtgaaggaaagcttc
gaacccatccggctgggagggatcggtgaaaaactggcccgggaaatcgaggagcggaca
gggatcgaatcccgctgcaccgtgctggggtatctccagcggggcggttctcccacggcc
tatgaccgggtcctgtccacccgctacggggcggcggcagtggaagcctgcctggatgag
gaatacaatgtgatggtgtccctccaggccaatgccatcgtccgggtgcccatcgcccag
gcagcgtccaaaccccatcaggtgccggtggattcggacatcgtccggaccggccgggaa
ctggggatttctttcggagacgaaaaaccggaagactga

DBGET integrated database retrieval system