KEGG   Acidaminococcus fermentans: Acfer_0254Help
Entry
Acfer_0254        CDS       T01151                                 

Definition
phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
afn  Acidaminococcus fermentans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:afn01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:afn01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:afn00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:afn00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:afn00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:afn00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:afn00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
308920..310038
Genome map
AA seq 372 aa AA seqDB search
MQEKKRGTLAVLTGGGDCPGLNAVIRAVVKTALHHGFQIYGISNGFHGLICNDMKLMSLS
DVSGILPRGGTILGTTNRDNPFHYAAGEDEKGNVIYEDRRDVVVRNLKDHGIDCLIVIGG
DGSLKIAHDLHRFCDVNVVGVPKTIDNDLPCTERTFGFDTAMAMATEALDRLHTTAESHH
RVMVLEVMGRYAGWIALHSGIAGGADVILIPEIPYDLDAVIRKIHQRQQNGKKFSIITVA
EGAKPIGGQLTIARMVKESFEPIRLGGIGEKLAREIEERTGIESRCTVLGYLQRGGSPTA
YDRVLSTRYGAAAVEACLDEEYNVMVSLQANAIVRVPIAQAASKPHQVPVDSDIVRTGRE
LGISFGDEKPED
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaaaagaaaagagggaccctggcggtcctcaccggcggaggcgattgtcccggt
ctgaacgctgtgatccgggccgtggtcaagacggctctccatcacgggttccagatttac
ggcatttccaacgggttccatgggctgatctgcaatgacatgaagcttatgagcctgtcc
gatgtgtccgggatcctgccccggggcgggaccatcctggggaccaccaaccgggacaac
cccttccattatgctgcaggcgaagatgaaaagggcaatgtaatctatgaagaccggcgg
gatgtggtggtccggaacctgaaggaccacggcatcgattgtctgattgtcatcggtggg
gacggcagcctgaaaatcgcccatgatctccatcggttctgtgatgtgaacgtggtgggg
gtgcccaagaccatcgacaatgatctgccctgtacggaacggaccttcggctttgatacg
gccatggccatggccacggaagccctggaccggctccataccacggcggaatcccatcac
cgggtcatggtgctggaggtcatgggacggtatgcaggctggatcgccctccattccggc
attgcaggaggagcggacgtgatcctgatcccggaaattccctatgacctggatgcggtg
atccgcaagatccaccagcgccagcagaatgggaagaagttcagcatcattaccgtggcg
gaaggggccaagcccatcggagggcagctgaccatcgcccggatggtgaaggaaagcttc
gaacccatccggctgggagggatcggtgaaaaactggcccgggaaatcgaggagcggaca
gggatcgaatcccgctgcaccgtgctggggtatctccagcggggcggttctcccacggcc
tatgaccgggtcctgtccacccgctacggggcggcggcagtggaagcctgcctggatgag
gaatacaatgtgatggtgtccctccaggccaatgccatcgtccgggtgcccatcgcccag
gcagcgtccaaaccccatcaggtgccggtggattcggacatcgtccggaccggccgggaa
ctggggatttctttcggagacgaaaaaccggaagactga

DBGET integrated database retrieval system