KEGG   Acidaminococcus fermentans: Acfer_0254Help
Entry
Acfer_0254        CDS       T01151                                 

Definition
(GenBank) phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
afn  Acidaminococcus fermentans
Pathway
afn00010  Glycolysis / Gluconeogenesis
afn00030  Pentose phosphate pathway
afn00051  Fructose and mannose metabolism
afn00052  Galactose metabolism
afn00680  Methane metabolism
afn01100  Metabolic pathways
afn01110  Biosynthesis of secondary metabolites
afn01120  Microbial metabolism in diverse environments
afn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:afn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acfer_0254
   00030 Pentose phosphate pathway
    Acfer_0254
   00051 Fructose and mannose metabolism
    Acfer_0254
   00052 Galactose metabolism
    Acfer_0254
  Energy metabolism
   00680 Methane metabolism
    Acfer_0254
Enzymes [BR:afn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Acfer_0254
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Acfer_0254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ADB46660
JGI: Acfer_0254
UniProt: D2RNN4
Position
308920..310038
Genome map
AA seq 372 aa AA seqDB search
MQEKKRGTLAVLTGGGDCPGLNAVIRAVVKTALHHGFQIYGISNGFHGLICNDMKLMSLS
DVSGILPRGGTILGTTNRDNPFHYAAGEDEKGNVIYEDRRDVVVRNLKDHGIDCLIVIGG
DGSLKIAHDLHRFCDVNVVGVPKTIDNDLPCTERTFGFDTAMAMATEALDRLHTTAESHH
RVMVLEVMGRYAGWIALHSGIAGGADVILIPEIPYDLDAVIRKIHQRQQNGKKFSIITVA
EGAKPIGGQLTIARMVKESFEPIRLGGIGEKLAREIEERTGIESRCTVLGYLQRGGSPTA
YDRVLSTRYGAAAVEACLDEEYNVMVSLQANAIVRVPIAQAASKPHQVPVDSDIVRTGRE
LGISFGDEKPED
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaaaagaaaagagggaccctggcggtcctcaccggcggaggcgattgtcccggt
ctgaacgctgtgatccgggccgtggtcaagacggctctccatcacgggttccagatttac
ggcatttccaacgggttccatgggctgatctgcaatgacatgaagcttatgagcctgtcc
gatgtgtccgggatcctgccccggggcgggaccatcctggggaccaccaaccgggacaac
cccttccattatgctgcaggcgaagatgaaaagggcaatgtaatctatgaagaccggcgg
gatgtggtggtccggaacctgaaggaccacggcatcgattgtctgattgtcatcggtggg
gacggcagcctgaaaatcgcccatgatctccatcggttctgtgatgtgaacgtggtgggg
gtgcccaagaccatcgacaatgatctgccctgtacggaacggaccttcggctttgatacg
gccatggccatggccacggaagccctggaccggctccataccacggcggaatcccatcac
cgggtcatggtgctggaggtcatgggacggtatgcaggctggatcgccctccattccggc
attgcaggaggagcggacgtgatcctgatcccggaaattccctatgacctggatgcggtg
atccgcaagatccaccagcgccagcagaatgggaagaagttcagcatcattaccgtggcg
gaaggggccaagcccatcggagggcagctgaccatcgcccggatggtgaaggaaagcttc
gaacccatccggctgggagggatcggtgaaaaactggcccgggaaatcgaggagcggaca
gggatcgaatcccgctgcaccgtgctggggtatctccagcggggcggttctcccacggcc
tatgaccgggtcctgtccacccgctacggggcggcggcagtggaagcctgcctggatgag
gaatacaatgtgatggtgtccctccaggccaatgccatcgtccgggtgcccatcgcccag
gcagcgtccaaaccccatcaggtgccggtggattcggacatcgtccggaccggccgggaa
ctggggatttctttcggagacgaaaaaccggaagactga

DBGET integrated database retrieval system