KEGG   Acidaminococcus fermentans: Acfer_0286Help
Entry
Acfer_0286        CDS       T01151                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
afn  Acidaminococcus fermentans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:afn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Acfer_0286
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Acfer_0286
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Acfer_0286
Enzymes [BR:afn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Acfer_0286
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
337727..338911
Genome map
AA seq 394 aa AA seqDB search
MSKGRFGRHGGQYVSETLMNAVLQLEEAYNRFKDDPEFLQELRTLYHDYANRPSLLYYAE
KMTKDLGGAKIYLKREDLNHTGAHKINNALGQCLLAKKMGKKRVIAETGAGQHGVATATV
AALMGLECEVYMGREDTIRQALNVYRMELLGAKVVPVTTGTGTLKDAVSEAMRDWCTNVE
DTFYVLGSCMGPHPYPTIVRDFQKVIGEEVKAQILEKEGRLPDVVMACVGGGSNAIGLFY
DFIPDRDVQLIGVEAAGRGVNTAETAATIARGKPGIFHGMESYFLQDEDGQIAPVYSISA
GLDYPGIGPEHANLYDTGRAQYVPITDDESVEAFEYLSRTEGIIPAIESAHAVAYAMKLA
PTLPKDKIIVVNLSGRGDKDVAAIARYKGVDLHD
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaggaagatttggcagacacggcggccagtatgtatcggaaaccctgatgaac
gcagtgctgcagctggaagaagcctacaaccgtttcaaggatgatccggaatttctccag
gaactccggaccctgtaccatgactatgccaaccggcccagcctgctgtactatgcggaa
aaaatgaccaaagacctgggaggcgccaagatctacctgaaacgggaagatctgaaccat
accggagcccacaagatcaacaatgccctgggccagtgcctgctggccaaaaagatgggg
aagaaacgggtcatcgccgaaaccggcgccggccagcacggggtggccacggctacggtg
gcggctctgatggggctggaatgtgaagtgtacatgggcagggaagacaccatccgccag
gccctgaacgtgtaccggatggaactcctgggagccaaagtggtccctgtgaccaccggc
accggtaccctgaaggacgcagtcagcgaggccatgcgggattggtgcaccaatgtggaa
gacaccttctatgtgctgggatcctgcatggggcctcacccctatcccaccatcgtccgt
gacttccagaaagtcatcggggaagaagtgaaggcccagattctggaaaaggaaggccgg
ctgcccgatgtggtcatggcctgcgtagggggcggcagcaatgccatcggcctgttctat
gatttcatcccggacagggatgtccagctgatcggagtggaagcggccggccggggcgtg
aatacggcggaaaccgccgccaccatcgcccgggggaaaccggggatcttccacgggatg
gaatcctatttcctccaggatgaagacgggcagatcgctccggtgtattccatttccgcc
ggactggattacccgggcatcgggccggaacacgccaatctgtacgataccggccgggcc
cagtatgtgcccataaccgatgatgaatccgtagaggcttttgaatatctgtcccggacg
gaaggaatcattcccgccattgaaagtgcccatgccgtggcctatgccatgaaactggca
cccaccctgcccaaggacaagatcattgtggtgaatctgtccggccggggggacaaggac
gtggctgccattgccagatacaagggggttgacctgcatgactag

DBGET integrated database retrieval system