KEGG   Acidaminococcus fermentans: Acfer_0287Help
Entry
Acfer_0287        CDS       T01151                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
afn  Acidaminococcus fermentans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:afn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Acfer_0287
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Acfer_0287
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Acfer_0287
Enzymes [BR:afn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Acfer_0287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
338904..339686
Genome map
AA seq 260 aa AA seqDB search
MTRITDAFKKQGKLFIPFITAGDPDLATTEKLIYAMEEAGAGLIEIGIPFSDPTAEGPVI
LEADTRALAAGTKIKDIFAMLARVREKTRIPMVFLTYANPIFTYGRDKFFQQCRDVEIDG
VIVPDVPFEEKATIAPEAEKYGVEIISMIAPTSHQRIQMIAKEAQGYIYLVSSLGVTGVR
KEITTNLKEIVEKIREVSDKPIAVGFGISTPEQAREMAAISDGAIVGSAIVKLCAQYGKD
CVEPVKQYVKKMAEAVDEAK
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgactaggattactgatgcattcaagaaacaggggaagctgttcattcccttcattacc
gccggggatccggacctggccactacggaaaaactgatctatgccatggaagaagcgggg
gccggcctcattgaaatcggcatccctttttctgatcccactgcggaaggaccggtgatc
ctggaagcggatacccgggccctggctgccgggaccaaaatcaaggacatctttgccatg
ctggcccgggtccgggaaaagacccggatccccatggtgttcctgacctatgcgaacccc
atcttcacctacggccgggacaagttcttccagcagtgccgggatgtggagatcgacggg
gtcatcgttcccgatgtaccttttgaagaaaaggccaccatcgctccggaagcggaaaaa
tacggggtggagatcatctccatgatcgcccccacctcccatcagcggatccagatgatt
gccaaagaagcccaggggtacatctacctggtttcctctttgggagtcaccggggtgcgg
aaagagattaccaccaacctgaaggaaatcgtggagaagatccgggaagtgtccgacaaa
cccattgccgtgggcttcgggatctccaccccggaacaggccagggaaatggcggcaatc
agcgacggagccatcgtgggcagcgccatcgtgaaactctgtgcccagtacggcaaagac
tgcgtggagccggtgaagcagtacgtaaagaaaatggcggaggccgtggacgaggcgaag
tga

DBGET integrated database retrieval system