KEGG   Acidaminococcus fermentans: Acfer_0287Help
Entry
Acfer_0287        CDS       T01151                                 

Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
afn  Acidaminococcus fermentans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:afn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Acfer_0287
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Acfer_0287
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Acfer_0287
Enzymes [BR:afn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Acfer_0287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
338904..339686
Genome map
AA seq 260 aa AA seqDB search
MTRITDAFKKQGKLFIPFITAGDPDLATTEKLIYAMEEAGAGLIEIGIPFSDPTAEGPVI
LEADTRALAAGTKIKDIFAMLARVREKTRIPMVFLTYANPIFTYGRDKFFQQCRDVEIDG
VIVPDVPFEEKATIAPEAEKYGVEIISMIAPTSHQRIQMIAKEAQGYIYLVSSLGVTGVR
KEITTNLKEIVEKIREVSDKPIAVGFGISTPEQAREMAAISDGAIVGSAIVKLCAQYGKD
CVEPVKQYVKKMAEAVDEAK
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgactaggattactgatgcattcaagaaacaggggaagctgttcattcccttcattacc
gccggggatccggacctggccactacggaaaaactgatctatgccatggaagaagcgggg
gccggcctcattgaaatcggcatccctttttctgatcccactgcggaaggaccggtgatc
ctggaagcggatacccgggccctggctgccgggaccaaaatcaaggacatctttgccatg
ctggcccgggtccgggaaaagacccggatccccatggtgttcctgacctatgcgaacccc
atcttcacctacggccgggacaagttcttccagcagtgccgggatgtggagatcgacggg
gtcatcgttcccgatgtaccttttgaagaaaaggccaccatcgctccggaagcggaaaaa
tacggggtggagatcatctccatgatcgcccccacctcccatcagcggatccagatgatt
gccaaagaagcccaggggtacatctacctggtttcctctttgggagtcaccggggtgcgg
aaagagattaccaccaacctgaaggaaatcgtggagaagatccgggaagtgtccgacaaa
cccattgccgtgggcttcgggatctccaccccggaacaggccagggaaatggcggcaatc
agcgacggagccatcgtgggcagcgccatcgtgaaactctgtgcccagtacggcaaagac
tgcgtggagccggtgaagcagtacgtaaagaaaatggcggaggccgtggacgaggcgaag
tga

DBGET integrated database retrieval system