KEGG   Acidaminococcus fermentans: Acfer_0287Help
Entry
Acfer_0287        CDS       T01151                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
afn  Acidaminococcus fermentans
Pathway
afn00260  Glycine, serine and threonine metabolism
afn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
afn01100  Metabolic pathways
afn01110  Biosynthesis of secondary metabolites
afn01130  Biosynthesis of antibiotics
afn01230  Biosynthesis of amino acids
Module
afn_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:afn00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Acfer_0287
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Acfer_0287
Enzymes [BR:afn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Acfer_0287
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB BtpA
Motif
Other DBs
NCBI-ProteinID: ADB46693
JGI: Acfer_0287
UniProt: D2RNR7
Position
338904..339686
Genome map
AA seq 260 aa AA seqDB search
MTRITDAFKKQGKLFIPFITAGDPDLATTEKLIYAMEEAGAGLIEIGIPFSDPTAEGPVI
LEADTRALAAGTKIKDIFAMLARVREKTRIPMVFLTYANPIFTYGRDKFFQQCRDVEIDG
VIVPDVPFEEKATIAPEAEKYGVEIISMIAPTSHQRIQMIAKEAQGYIYLVSSLGVTGVR
KEITTNLKEIVEKIREVSDKPIAVGFGISTPEQAREMAAISDGAIVGSAIVKLCAQYGKD
CVEPVKQYVKKMAEAVDEAK
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgactaggattactgatgcattcaagaaacaggggaagctgttcattcccttcattacc
gccggggatccggacctggccactacggaaaaactgatctatgccatggaagaagcgggg
gccggcctcattgaaatcggcatccctttttctgatcccactgcggaaggaccggtgatc
ctggaagcggatacccgggccctggctgccgggaccaaaatcaaggacatctttgccatg
ctggcccgggtccgggaaaagacccggatccccatggtgttcctgacctatgcgaacccc
atcttcacctacggccgggacaagttcttccagcagtgccgggatgtggagatcgacggg
gtcatcgttcccgatgtaccttttgaagaaaaggccaccatcgctccggaagcggaaaaa
tacggggtggagatcatctccatgatcgcccccacctcccatcagcggatccagatgatt
gccaaagaagcccaggggtacatctacctggtttcctctttgggagtcaccggggtgcgg
aaagagattaccaccaacctgaaggaaatcgtggagaagatccgggaagtgtccgacaaa
cccattgccgtgggcttcgggatctccaccccggaacaggccagggaaatggcggcaatc
agcgacggagccatcgtgggcagcgccatcgtgaaactctgtgcccagtacggcaaagac
tgcgtggagccggtgaagcagtacgtaaagaaaatggcggaggccgtggacgaggcgaag
tga

DBGET integrated database retrieval system