KEGG   Acidaminococcus fermentans: Acfer_0375Help
Entry
Acfer_0375        CDS       T01151                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
afn  Acidaminococcus fermentans
Pathway
afn00071  Fatty acid degradation
afn00280  Valine, leucine and isoleucine degradation
afn00310  Lysine degradation
afn00362  Benzoate degradation
afn00380  Tryptophan metabolism
afn00620  Pyruvate metabolism
afn00630  Glyoxylate and dicarboxylate metabolism
afn00640  Propanoate metabolism
afn00650  Butanoate metabolism
afn00900  Terpenoid backbone biosynthesis
afn01100  Metabolic pathways
afn01110  Biosynthesis of secondary metabolites
afn01120  Microbial metabolism in diverse environments
afn01130  Biosynthesis of antibiotics
afn01200  Carbon metabolism
afn01212  Fatty acid metabolism
afn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:afn00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Acfer_0375
   00630 Glyoxylate and dicarboxylate metabolism
    Acfer_0375
   00640 Propanoate metabolism
    Acfer_0375
   00650 Butanoate metabolism
    Acfer_0375
  Lipid metabolism
   00071 Fatty acid degradation
    Acfer_0375
   00072 Synthesis and degradation of ketone bodies
    Acfer_0375
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Acfer_0375
   00310 Lysine degradation
    Acfer_0375
   00380 Tryptophan metabolism
    Acfer_0375
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Acfer_0375
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Acfer_0375
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Acfer_0375
Enzymes [BR:afn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Acfer_0375
Exosome [BR:afn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Acfer_0375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ADB46781
JGI: Acfer_0375
UniProt: D2RP05
Position
437199..438407
Genome map
AA seq 402 aa AA seqDB search
MEGRDVYLVAGLRSHLGLQNGIFKEVPPEKLGAALLRQLCVQVPVAREAQLVIGGNAVGS
GGNLMRLMALTAGLPAELPAMTLDMQCASALGALSLAWGQIASGQLELVLCGGVESSSLQ
PRRVYQPWDSRYTPEGYMTAQFSPDTHSPRAMLEGAERTAQVYGVSREELDRWAVRSHRK
AAEAWEEGRLEPWVVSLFGSTRDESIRPRMNGRLARRMPTLFTREETEILLTPEEAKLAG
DGTPTLTAANACLTQDGAAFLVLASGEKLAEWRRAGKPVRPLARILHCTAAGVDPRFSPL
GALAVGEKLLEETGLPVEAIDDFEYNEAFAVISALFARHYPTCTDRYLPLGGALAYGHPY
GCSGAVLVLHALAALEGQEGKKALCAIAGAGGTGAGVLLETL
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggagggccgtgacgtctatctggtggccgggctgcgcagccacctgggattacagaat
ggcatatttaaggaagttccgccggagaagctgggcgctgcccttctccggcagctttgc
gtccaggtgccggtggccagggaggctcagctggtcattggaggcaacgccgtgggcagt
ggcggcaacctgatgcggctcatggccctgacggccggactgccagcggaactgcccgcc
atgaccctagacatgcagtgcgcttccgccctgggagccctatccctggcctgggggcag
atcgccagcggtcagctggagctggtgctgtgcgggggcgtggaatcgtcctccctgcag
ccccgacgggtgtaccagccctgggacagccggtacactccggaaggatatatgaccgcc
cagttttctccggatacccacagcccccgggccatgctggaaggggcggaacggacggcc
caggtgtacggggtttcccgggaggaactggaccggtgggcggtacgcagccaccggaag
gcggcggaagcctgggaggaaggacggctggaaccctgggtggtgtccctgttcggcagt
acccgggatgaaagcatccggccccggatgaacggacggctggcccggcggatgcccacc
ctgttcacccgggaggaaacggaaatcctgctgaccccggaagaagcgaaactggcgggg
gacggcacccccaccttgaccgcggccaatgcctgcctgacccaggacggggcggcgttc
ctggtgctggcctccggagaaaaactggcggagtggcgccgggcaggaaagccggtgcgc
cctctggcccggatcctccactgcacggcggcaggggtggatccccggttcagtcccctg
ggagccctggcagtgggggaaaagctgctggaagaaaccggcctgccggtggaggccatc
gatgattttgaatacaatgaagcctttgccgtgatctccgccctgtttgcccggcattac
cccacctgtacggaccgatacctgcccttggggggtgctctggcctacggccatccctat
gggtgcagtggagccgtgctggtgctccatgctctggcagccctggagggccaggaagga
aagaaagccctgtgcgccattgccggtgccgggggaacgggagccggggtgctcctggaa
acgctgtag

DBGET integrated database retrieval system