KEGG   Acidaminococcus fermentans: Acfer_0402Help
Entry
Acfer_0402        CDS       T01151                                 

Definition
glycogen/starch/alpha-glucan phosphorylase (EC:2.4.1.1)
Orthology
K00688  
starch phosphorylase [EC:2.4.1.1]
Organism
afn  Acidaminococcus fermentans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:afn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Acfer_0402
Enzymes [BR:afn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     Acfer_0402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
476951..479368
Genome map
AA seq 805 aa AA seqDB search
MTKNWKSPKQFVCLFTQKAKILFNEEPAALTPKKVYLVLANLVKDLIYDDWLATEQRYDA
RQTKQVYYFSIEFLLGRLLDANLMNCGMENMAREGLKELGFDLDAIMPLEADPGLGNGGL
GRLAACFIDSLAALQLPGHGCSIRYQYGLFEQHIVDGQQVELPDTWLQDGFPWETKRSDK
AVHVRYGGSAYMRPDGKGGLECVHEGYSSVLAIPYDVPVPGYRNHTVNTLRLWQAEYTPD
GLFGQGQGGDFRKVLQYRDTTQQISRFLYPDDSTEEGRKLRLMQEYFFVSAGLQSIVRHY
RGQHRDLREFDRYVALHINDTHPALLIPELMRILMDEEGMGWEEAWRITVASTSYTNHTI
MPEALERWSIPLFQSLLPRVYLIVEELNRRWLAAYRRKFPGREDKAEQVAILWGGQVRMA
NLAVVGSHSVNGVAELHTKILEESTLHPFYEVYPERFNNKTNGVTHRRWLLESNPPLAAL
ISDTIGTDWIRHPKKLKELLPYRDDPSFQEKLAQVKQDRKDALVRWIQETRGVAVDPHSL
FDIQIKRFHMYKRQLLNILHVYSLYLRLLDDPDAVPLPQTFLFGGKAAASYGEAKVVIKL
IHTVARLIDQEPRVREKLKVLFLENYNVSLGQRLFPAADVSEQISTASKEASGTGNMKFM
MNGAITLGTLDGANVEIHRLVGDENCVIFGLRAEEVQKYYREGGYSSWDLYRQDEEIRRV
LDVFQKNPLFSQLYEDLLRRNDEYFVLKDFAAYREAHQEILRRYQDRPGWLRASAVNIAQ
SGHFSSDRTVSQYARDIWKVKPIRV
NT seq 2418 nt NT seq  +upstreamnt  +downstreamnt
attacgaaaaactggaaaagtccgaaacaatttgtctgtctcttcacccagaaggccaag
atccttttcaatgaggaaccggcagcgctgacaccgaaaaaagtgtacctggtgctggcc
aacctggtgaaggacctgatttacgatgactggctggctacggaacagcggtatgacgcc
cggcagaccaaacaggtgtattatttcagcatcgaattcctgctgggccggctgctggat
gccaacctgatgaactgcggcatggagaacatggcccgggagggcctgaaggaactggga
ttcgacctggatgccatcatgcccctggaggcggatccggggctgggcaacgggggcctg
ggccgtctggcggcctgtttcatcgattccctggcggctctccagctgccgggccacggg
tgcagcatccggtaccagtacggtctcttcgaacagcatattgtggacggccagcaggtg
gaactgccggatacctggctccaggacggattcccctgggaaaccaaaaggtcggacaag
gcggtccatgtccggtacgggggctccgcctacatgcggccggacggcaaggggggactg
gaatgtgtccatgaagggtacagctcggtgctggccatcccctacgatgtgccggtgccc
gggtatcggaaccatacggtgaacaccctgcggctgtggcaggcggaatacaccccggac
gggctgttcggccagggccaggggggcgatttccggaaagtgctccagtaccgggacacc
acccagcagatttcccggttcctgtatccggatgattccacggaagagggccggaagctg
cggctgatgcaggagtatttcttcgtgtccgccggactccagagcatcgtccgtcattac
cggggccagcaccgggatctccgggagttcgaccggtatgtggccctccacatcaatgac
acccatccggcccttctgatcccggaactgatgcggatcctgatggacgaggaagggatg
ggctgggaggaagcctggcggatcaccgtagccagcacctcctacaccaaccacaccatt
atgccggaagccctggaacggtggtccattcccctgttccagagcctgctgccccgggtg
tatctgatcgtggaggaactgaaccggcgctggctggcggcctatcggagaaaattcccg
ggacgggaggacaaggcggaacaggtggccatcctctggggcggccaggtgcgcatggcc
aacctggcggtggtggggagccacagtgtcaacggggtggcggaactccacacgaagatc
ctggaagagagcaccctccatcccttctacgaagtgtatccggaacggttcaacaacaag
accaacggggtgacccaccggcgctggctgctggaatccaatccgcccctggcggcgctg
atttcggacaccatcggtacggactggatccggcatccgaagaaactgaaggaactgctg
ccctaccgggacgacccgtctttccaggagaaactggcccaggtgaaacaggaccggaag
gatgccctggtccggtggatccaggaaaccaggggagtggcggtggatccccattccctg
ttcgatatccagatcaaacggttccatatgtacaagcggcagctgctgaacatcctccat
gtgtattccctgtatctgcggctgctggatgatccggatgcggtgcccctgccccagacc
ttcctgttcggaggcaaggcggcggcgtcctacggggaagccaaggtggtgatcaagctg
atccataccgtggcccggctcatcgaccaggaaccccgggtccgggagaagctgaaggtg
ctgttcctggaaaactacaacgtgtccctgggccagcggctgttcccggcggcggatgtg
agcgagcagatctccacggccagcaaggaggcctccggcaccggcaacatgaagttcatg
atgaacggggccattaccctgggcaccctggacggggccaatgtggagatccaccggctg
gtgggggacgaaaactgcgtgatcttcggcctccgggcggaagaagtccagaagtactac
cgggaaggggggtattcttcctgggatctgtaccggcaggatgaggaaatccgccgggtg
ctggacgtgttccagaagaatcccctgttcagccagctgtatgaagacctgctccggcgg
aatgatgaatatttcgtcctgaaggatttcgccgcctaccgggaagcccatcaggagatc
ctccgccggtatcaggaccggccgggctggctccgggcgtcggcggtgaacatcgcccag
tccggccatttttccagcgaccggaccgtgtcccagtacgcccgggatatctggaaggtc
aagcccatacgggtgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system