KEGG   Acidaminococcus fermentans: Acfer_0403Help
Entry
Acfer_0403        CDS       T01151                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
afn  Acidaminococcus fermentans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:afn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Acfer_0403
Enzymes [BR:afn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Acfer_0403
Exosome [BR:afn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Acfer_0403
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
479417..481408
Genome map
AA seq 663 aa AA seqDB search
MRLSAIDSYSMYLFHNGTNGSSCRLLGAHRTVWRRKPCVRFSVWAPHAQKVSVVGDFNDW
NPETHPMERAEDGEIWKRYIPDLPEGTLYKYAIVTPSGETILKADPYGFRAQLRPDTASV
VASLNYRWRDGAWRKKQAAGDSYSRPMNIYEVHAGSWRQHPDGSFYSYRELAEELVPYVK
DMNYTHVELMPLCEYPFDGSWGYQATGYFAPTSRYGEPEDLMYLVDQCHRNGIGVILDWV
PGHFCRDAHGLRHFDGEPLYESGNPLLAENKDWDTMNFDYGRPEVRSFLISSALFWLEEY
HFDGLRIDAVASMLYLDYGKKEGEWQANKYGGRENLEAVEFLRQLNTAVFREMPQALMVA
EESTTWPLVSRPVDQGGLGFNYKWNMGWMNDMLQYMSTDPLFRKGCQDLITFSLYYAFSE
NFILPLSHDEVVHGKKSLIDRMPGDYWQKFAGLRAFYGYWMSHPGKKLLFMGGEFGQFIE
WRYAEQLDWLLLDYPMHRQMQDYSRDLNRYYLDHPEFWQEDFDWKGFQWISCDDRDNSVI
AFVRTGKEPGTETVVVCNFTPVVRREYRIGAPEPGTWQEVFNSDAEAFGGSGVRSGTLQE
NGKVEIRTEKVPCHGREQSLVLTLPPLAVVYFQRKKETAEKQNTPLGKKKMEGDSHESVI
GSV
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgcgtctcagtgccattgattcttacagtatgtacctgttccacaacgggaccaacgga
agcagctgccggctgctgggggctcatcggacggtatggcgccggaagccctgtgtccgg
ttttccgtctgggcgccccatgcccaaaaagtcagcgtggtgggggatttcaatgactgg
aatccggaaacccaccccatggaacgggcggaggacggagagatctggaaacgctacatc
ccggatctgccggaagggactctttacaaatatgccattgtcaccccctcgggagaaacc
atcctgaaggcggatccctacgggttccgggcccagctgcggccggatacggcgtcggtg
gtggcgtccctgaactaccggtggcgggacggggcctggcggaagaaacaggcagcgggg
gattcctacagccgtcccatgaatatctatgaagtccacgcaggcagctggcggcagcac
ccggacggcagtttctacagctaccgggagctggcggaggaactggtcccctatgtgaag
gacatgaactacacccatgtggagctgatgcccctgtgcgaatatccctttgacggatcc
tgggggtatcaggccaccgggtattttgcacccaccagccggtacggggagccggaagac
ctgatgtatctggtggaccagtgccaccggaacggcatcggggtgatcctggactgggtg
cccggccatttctgccgggacgcccacggcctgcgccatttcgacggggaacccctgtat
gaatccgggaaccccctgctggcggaaaataaggactgggacaccatgaactttgattac
ggccgtccggaagtccggagtttcctgatttccagcgccctgttctggctggaggaatac
catttcgacgggctgcggatcgatgcggtagccagcatgctctacctggactatgggaaa
aaagagggagaatggcaggccaacaagtacggaggacgggagaacctggaagccgtggaa
ttcctccggcagctgaacacggcggtgttccgggaaatgccccaggccctgatggtggcc
gaggaaagcaccacctggccgctggtttcccggccggtggaccaggggggcctgggcttc
aactacaaatggaacatgggctggatgaacgacatgctccagtacatgagcacggatccc
ctgttccggaaagggtgccaggacctgattaccttttccctgtattatgcgttttccgag
aattttatcctgcccctgtcccatgacgaagtggtccacgggaagaaatccctcatcgac
cggatgcctggggattactggcagaaattcgccgggctccgggccttttacgggtactgg
atgagccatcccgggaagaaactgctctttatgggcggggaattcggtcagttcatcgaa
tggcggtatgcggagcagctggactggctgctgctggactaccccatgcaccggcagatg
caggattacagccgggatctgaaccggtactatctggaccatccggaattctggcaggag
gattttgactggaaggggttccagtggatcagctgcgacgaccgggacaacagcgtcatt
gcctttgtccgtaccgggaaagagccggggacggaaacggtggtggtgtgcaatttcacc
ccggtggtccggcgggaataccggatcggggctcctgagccgggaacctggcaggaagtg
ttcaacagtgatgcagaagccttcgggggcagcggagtccggagcggcaccctccaggaa
aacggaaaagtggagatccggacggaaaaggttccctgccacggccgggagcaatccctg
gtgctgacactgccgcctctggcagtggtgtatttccagcggaaaaaggaaacagcagaa
aaacagaatacccctctggggaaaaagaaaatggaaggtgattcccatgaaagtgttatt
ggcagcgtctga

DBGET integrated database retrieval system