KEGG   Acidaminococcus fermentans: Acfer_0405Help
Entry
Acfer_0405        CDS       T01151                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
afn  Acidaminococcus fermentans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:afn00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
483057..486419
Genome map
AA seq 1120 aa AA seqDB search
MEITAYHDSRQTACRFPFGAVPGGTAVTLHLTVQGDGTEAVFLRLWQDNREILLPMACRE
TEPEPPDRTEIRERRYGVTFSVPDRGTLVWYYFVLRLGERTLYYGNNEARQGGMGRLWDR
EPPSYQITVYDRDSVTPAWLKQAVVYQIFPDRFCRGPVSADRFQGKPGALIHSTWEGNPC
YVKDERGQVRYYDFYGGTLEGILEKLPYLEELGVNCLYLNPIFQARSNHRYDTGDYKAID
PFLGTEETFRTLCREARRHGMRIILDGVFSHTGADSRYFNREGTYGEPGAWQGPDSPYYG
WYQFRDGGEDYACWWGDHSLPEVTETEPSYLDFIIRDRDSVLKHWLDAGISGWRLDVADE
LPDGFLTCFYRELKQKDPEAVLIGEVWEDASNKESYGVQRQYLSGGKLDSVMNYVLRDLM
LDFALGRADAGEADRRYWHQAENYPRENLYAMLNLLGSHDVERIRTLLEARYPGGEALRM
EGLLRAWQMTLPGAPSVYYGDEAGLTGGKDPENRKPFPWGKEEPSLEGCCRSLIHLRRQH
TALSTGRFQTFLARGDVYVYGRFLEGGRDVFGQPGENGVFVTALNRGEQALQVEVQTDGP
AWGELEPLWSLEDWMGYGDTGKEPKQAPKPIPVTGGDFVLDLPPRSGLIYRCREKKALPP
ERPRMERGAGVLLHPTSLPGENGREILESAIRFLDFLQAAGQKIWQILPLNPPGLGDSPY
LSLSAFAGQEELLAGAFPLPRADDPEFAVFRRRQQYWLEDYALFQAIRKQYGGMPWQQWP
EALKERNPEALARAGQELAEEVTRAAGKQYVFFKAWGKIRRAARDRGITLLGDMPLFVAP
DSADVWAHREYFQLDGDGYPTEVAGVPPDYFSAQGQVWGNPLYRWDAMAQDGWRWWQERF
RVLGEEADWVRIDHFRGFEALWAVPAGARDARQGRWKPGPGAALFHAVEQAVPDLGFVAE
DLGLITRPVTELREGLGFPGMRILQFHTRTRQDGLTDFATEPGCLAYTGTHDNNTLLGWL
QEDLDEETFARIWQMVMPGEAGAPDRSRAREMTEPLLRYLYSRNARWAMVPGQDLLGLGS
GSRMNIPGTPEGNWQWKLKKGQLPRELAERLRKMVREWGR
NT seq 3363 nt NT seq  +upstreamnt  +downstreamnt
gtggagattactgcttatcatgattcacgccagacagcttgccgttttccctttggagcg
gtccccggagggactgccgttaccctgcatcttacggtgcagggcgacgggacggaagct
gtttttttgcgtctctggcaggacaaccgggaaatcctcctgcccatggcctgcagggag
acggaaccggagccgccggacaggacggaaatccgggaacgccggtacggggtgaccttt
tccgtgccggaccggggaaccctggtctggtattattttgtcctccgtctgggggagagg
accctgtattacgggaacaatgaggcccggcagggaggcatgggccggctgtgggaccgg
gagcctccctcttaccagattactgtgtatgaccgggattccgtgacgccggcctggctg
aaacaggcggtggtgtaccagatcttcccggaccggttctgccggggaccggtatctgca
gaccggttccagggaaagccgggggccctgatccacagcacctgggaagggaatccctgc
tatgtgaaggatgaacggggccaggtacggtattacgatttttacggtgggaccctggag
ggaatcctggaaaaactgccttacctggaggagctgggggtgaactgcctgtacctgaac
cccattttccaggcccggagcaaccaccggtacgataccggggactacaaagccatcgat
cccttcctgggcacggaggagaccttccggaccctgtgccgggaagcacggcgccatggg
atgcggattatcctggacggggtgttcagccacaccggagcggacagccggtacttcaac
cgggaagggacctatggggagccgggggcctggcagggaccggattccccttattatggc
tggtaccagttccgggacggtggggaggactatgcctgctggtggggggatcattccctg
ccggaagtgacggaaacggagccctcctacctggatttcatcatccgggaccgggacagc
gtgctgaagcactggctggatgcaggaatcagcggctggcggctggatgtggccgatgaa
ctgccggacggattcctcacctgtttctaccgggaactgaaacagaaggatccggaagcg
gtgctgatcggggaggtgtgggaggatgcctccaacaaggaaagctacggggtccagcgc
cagtatctgtccgggggaaaactggacagtgtgatgaactatgtgctccgggatctgatg
cttgattttgccctgggacgggccgatgcaggggaagcggaccgccggtactggcaccag
gcggaaaactatccccgggagaacctgtacgccatgctgaacctgctgggcagccatgat
gtggagcggatccggaccctgctggaggcccggtatcccggaggggaggccctgcggatg
gaagggctgctccgggcctggcagatgaccctgccgggggctccttcggtgtattatggg
gacgaagcgggcctgaccgggggcaaagacccggagaaccggaagccctttccctggggg
aaggaagagccttccctggaaggctgctgccggagcctgatccatctccgccggcagcac
accgccctgtccaccggccggttccagaccttcctggcccggggagatgtgtatgtgtac
ggtcggttcctggaagggggccgggatgtgttcggtcagccgggcgaaaacggggtcttt
gttaccgccctgaaccggggggagcaggctctgcaggtggaggtccagacagatggaccg
gcctggggcgaactggagcctctctggagcctggaagactggatggggtatggcgataca
ggaaaggaaccgaaacaggctccaaagcccattccggtgacaggcggggattttgtcctg
gacctgccgccccggagtgggttgatctaccggtgccgggaaaagaaggctctgccgccg
gaacggccccggatggaacggggagccggggtgctgctccatcccacttccctgccggga
gaaaacggccgggagatcctggaatccgccatccggttcctggatttcctccaggccgcc
ggccagaagatctggcagatcctgcccctgaatccgccgggcctgggggattctccctat
ctctctctttcggcttttgccggacaggaagaactgctggccggagcttttcccctgccc
cgggcggatgatccggaatttgctgtgttccgccggagacagcagtactggctggaggac
tatgccctgttccaggccatccggaagcagtatggaggaatgccctggcagcagtggccg
gaagccctgaaggaacggaatccggaagccctggccagggccggacaggagctggcggaa
gaagtgacccgggcggccggaaagcagtatgtgttcttcaaggcatgggggaagatccgc
cgggcggcccgggacaggggcatcaccctcctgggagacatgccccttttcgtggctccg
gacagcgccgatgtgtgggcccaccgggaatatttccagctggacggggacggctatcct
acggaagtggccggggtgcccccggattatttcagcgcccagggccaggtgtgggggaat
cccctgtaccggtgggatgccatggctcaggacggctggcgctggtggcaggaacggttc
cgggtactgggcgaagaagcggactgggtgcggatcgaccatttccggggctttgaggct
ctgtgggcggtgcctgcaggagcccgggatgcccgtcagggccggtggaaaccgggtccc
ggcgctgccctgttccatgcagtggaacaggcggtgccggacctgggatttgtggccgaa
gacctggggctcatcacccggccggtgacggaactccgggaagggctgggctttccgggg
atgcggatcctccagttccatacccggacccggcaggacgggctcacggattttgccacg
gagcccggctgcctggcctataccgggacccacgacaacaataccctgctgggctggctc
caggaagatctggatgaggaaaccttcgcccggatctggcagatggtgatgcccggggaa
gccggtgctccggaccggagccgggccagggaaatgacggagcccctgctccggtacctg
tacagccggaatgccaggtgggccatggtgccgggccaggatctcctgggcctgggctcc
ggcagccggatgaacattcccggtacccccgagggcaactggcagtggaagctgaaaaaa
ggccagctgccccgggagctggcggaaagattgagaaagatggtgagggaatggggccgc
tga

DBGET integrated database retrieval system