KEGG   Acidaminococcus fermentans: Acfer_0931Help
Entry
Acfer_0931        CDS       T01151                                 

Definition
triosephosphate isomerase
Orthology
K00927  
phosphoglycerate kinase [EC:2.7.2.3]
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
afn  Acidaminococcus fermentans
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:afn01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:afn01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:afn00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:afn00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1071228..1073153
Genome map
AA seq 641 aa AA seqDB search
MDKKTVKDIQLTGKRVLVRVDYNVPMNDKGEITDFIRIEASLPTLHYLLDQGAAVILMAH
LGRPKGKVNPKFTLKPVAEALSQLIHRPVQFCPDCVGKDAQDAAAQLRNGDILLLENLRF
HPEEEKNDPHFAQELAALGDVYVNDGFGVSHRAHASVEAVTHYLPAVAGFLLEKEIAYLG
NAVDKPQRPFAAIIGGAKVADKIAVIRSLIKKADVILIGGGMANTFLAAKGYNLGKSLVE
KESLGIAKDLLAEAAAQKTKMLLPVDLIMAASFSNEADHEAEDLDALNPDYMALDIGPKT
AELYAQTLAGMKTIVWNGPMGVFEMPNYAEGTRRVAEAMAASDGITIVGGGDSAAAVKQM
GLADKMSHVSTGGGASLEYLEGKVLPGLAALDDLRTPIVAGNWKCHKTVAEAMELAHQVA
HGTEMARAEVVLFPPFTALESVAAMVDEDGIGYGAQDIFYEDEGSYTGAVSGPMIAEIGS
RYVLVGHSERRKFFHETNDLVVKKVLAAFRNDLDPVLCVGEDADEHENGSTKDKILSQLT
PVLNVLTDGQIQHLLVAYEPVWAIGSGKSAEVRDAVAAADLIRKAVAEKFGKEAARRVRI
LYGGSVTSENAHAFHEDGIDGVLVGGASLSAQEFCAIANTF
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atggataaaaaaaccgttaaagatattcagctgaccggcaaacgggtgctggtccgggta
gactacaacgttcccatgaacgacaaaggggaaatcacggatttcatccgcatcgaagcc
tctctgcccaccctccactacctgctggaccagggagccgcagtgatcctgatggctcac
ctgggccgtcccaaaggcaaggtgaaccccaagttcaccctgaagcccgtggcggaagcc
ctgagccagctgatccaccgtccggtgcagttctgcccggactgcgtgggcaaggatgcc
caggatgcagctgcccagctgcggaacggggatatcctgctgctggaaaacctccggttc
catccggaagaagaaaagaatgacccccattttgcccaggaactggcggctctgggggat
gtatatgtgaacgacgggttcggggtatcccaccgggcccatgcttccgtggaagccgtt
acccactacctgcccgccgtggccggtttcctgctggaaaaggaaatcgcatacctgggc
aatgccgtggacaaaccccagcgtccctttgccgccatcatcggcggggctaaagtggcg
gacaagatcgccgtgatccgcagcctgatcaaaaaggctgacgtgatcctgatcgggggc
ggcatggccaacaccttcctggcggccaaaggctacaacctggggaaatccctggtggaa
aaggaaagcctgggaatcgccaaggatctgctggcggaagccgcagcccagaagaccaaa
atgctcctgccggtggatctgatcatggctgccagcttctccaatgaggcggaccatgaa
gcagaagacctggatgccctgaacccggactacatggccctggatatcggccccaaaacg
gcagaactgtatgcccagaccctggccggcatgaagaccattgtgtggaacgggcccatg
ggtgtgttcgaaatgcccaactatgcggaagggacccggcgggtggcagaagccatggcc
gcttctgacggcatcaccatcgtgggcggcggcgacagtgcagccgctgtgaagcagatg
ggcctggccgataagatgagccatgtatccaccggtggcggtgcttccctggaatacctg
gaaggcaaagtgctgcccggcctggctgccctggatgatctgcggactcccattgtggcc
ggcaactggaaatgccacaagaccgtggcggaagccatggaactggctcaccaggtggcc
catggcacggaaatggcccgggctgaagtggtgctgttcccgcctttcactgccctggaa
agcgtagcggccatggtggatgaagacggcatcggctacggggcccaggacatcttctat
gaagatgaaggctcctacaccggcgctgtatccggccccatgattgcggaaatcgggtcc
cggtacgtgctggtgggccacagcgaacggcggaaattcttccatgaaaccaatgacctg
gtggtgaagaaggtcctggctgctttccggaacgacctggatccggtgctgtgcgtggga
gaagacgcggacgaacatgaaaacggctccaccaaagacaagatcctgagccagctgacg
ccggtcctgaatgtgctcaccgacgggcagatccagcatctgctggttgcctacgaaccg
gtttgggccattggcagcggcaagagcgctgaagtgcgggatgccgtggctgctgcggac
ctgatccggaaagctgttgcggaaaaattcggcaaagaggcggcccggcgggtccggatc
ctctacggcggcagtgtgaccagcgaaaatgcccatgccttccatgaagacggcatcgat
ggcgtactggtaggcggggccagcctgtctgcccaggaattctgcgccattgccaacacg
ttctga

DBGET integrated database retrieval system