KEGG   Acidaminococcus fermentans: Acfer_0931Help
Entry
Acfer_0931        CDS       T01151                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K00927  
phosphoglycerate kinase [EC:2.7.2.3]
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
afn  Acidaminococcus fermentans
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:afn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Acfer_0931
   01230 Biosynthesis of amino acids
    Acfer_0931
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acfer_0931
   00051 Fructose and mannose metabolism
    Acfer_0931
   00562 Inositol phosphate metabolism
    Acfer_0931
Enzymes [BR:afn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.3  phosphoglycerate kinase
     Acfer_0931
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Acfer_0931
Exosome [BR:afn04147]
 Exosomal proteins
  Proteins found in most exosomes
   Acfer_0931
  Exosomal proteins of colorectal cancer cells
   Acfer_0931
  Exosomal proteins of bladder cancer cells
   Acfer_0931
  Exosomal proteins of melanoma cells
   Acfer_0931
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1071228..1073153
Genome map
AA seq 641 aa AA seqDB search
MDKKTVKDIQLTGKRVLVRVDYNVPMNDKGEITDFIRIEASLPTLHYLLDQGAAVILMAH
LGRPKGKVNPKFTLKPVAEALSQLIHRPVQFCPDCVGKDAQDAAAQLRNGDILLLENLRF
HPEEEKNDPHFAQELAALGDVYVNDGFGVSHRAHASVEAVTHYLPAVAGFLLEKEIAYLG
NAVDKPQRPFAAIIGGAKVADKIAVIRSLIKKADVILIGGGMANTFLAAKGYNLGKSLVE
KESLGIAKDLLAEAAAQKTKMLLPVDLIMAASFSNEADHEAEDLDALNPDYMALDIGPKT
AELYAQTLAGMKTIVWNGPMGVFEMPNYAEGTRRVAEAMAASDGITIVGGGDSAAAVKQM
GLADKMSHVSTGGGASLEYLEGKVLPGLAALDDLRTPIVAGNWKCHKTVAEAMELAHQVA
HGTEMARAEVVLFPPFTALESVAAMVDEDGIGYGAQDIFYEDEGSYTGAVSGPMIAEIGS
RYVLVGHSERRKFFHETNDLVVKKVLAAFRNDLDPVLCVGEDADEHENGSTKDKILSQLT
PVLNVLTDGQIQHLLVAYEPVWAIGSGKSAEVRDAVAAADLIRKAVAEKFGKEAARRVRI
LYGGSVTSENAHAFHEDGIDGVLVGGASLSAQEFCAIANTF
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atggataaaaaaaccgttaaagatattcagctgaccggcaaacgggtgctggtccgggta
gactacaacgttcccatgaacgacaaaggggaaatcacggatttcatccgcatcgaagcc
tctctgcccaccctccactacctgctggaccagggagccgcagtgatcctgatggctcac
ctgggccgtcccaaaggcaaggtgaaccccaagttcaccctgaagcccgtggcggaagcc
ctgagccagctgatccaccgtccggtgcagttctgcccggactgcgtgggcaaggatgcc
caggatgcagctgcccagctgcggaacggggatatcctgctgctggaaaacctccggttc
catccggaagaagaaaagaatgacccccattttgcccaggaactggcggctctgggggat
gtatatgtgaacgacgggttcggggtatcccaccgggcccatgcttccgtggaagccgtt
acccactacctgcccgccgtggccggtttcctgctggaaaaggaaatcgcatacctgggc
aatgccgtggacaaaccccagcgtccctttgccgccatcatcggcggggctaaagtggcg
gacaagatcgccgtgatccgcagcctgatcaaaaaggctgacgtgatcctgatcgggggc
ggcatggccaacaccttcctggcggccaaaggctacaacctggggaaatccctggtggaa
aaggaaagcctgggaatcgccaaggatctgctggcggaagccgcagcccagaagaccaaa
atgctcctgccggtggatctgatcatggctgccagcttctccaatgaggcggaccatgaa
gcagaagacctggatgccctgaacccggactacatggccctggatatcggccccaaaacg
gcagaactgtatgcccagaccctggccggcatgaagaccattgtgtggaacgggcccatg
ggtgtgttcgaaatgcccaactatgcggaagggacccggcgggtggcagaagccatggcc
gcttctgacggcatcaccatcgtgggcggcggcgacagtgcagccgctgtgaagcagatg
ggcctggccgataagatgagccatgtatccaccggtggcggtgcttccctggaatacctg
gaaggcaaagtgctgcccggcctggctgccctggatgatctgcggactcccattgtggcc
ggcaactggaaatgccacaagaccgtggcggaagccatggaactggctcaccaggtggcc
catggcacggaaatggcccgggctgaagtggtgctgttcccgcctttcactgccctggaa
agcgtagcggccatggtggatgaagacggcatcggctacggggcccaggacatcttctat
gaagatgaaggctcctacaccggcgctgtatccggccccatgattgcggaaatcgggtcc
cggtacgtgctggtgggccacagcgaacggcggaaattcttccatgaaaccaatgacctg
gtggtgaagaaggtcctggctgctttccggaacgacctggatccggtgctgtgcgtggga
gaagacgcggacgaacatgaaaacggctccaccaaagacaagatcctgagccagctgacg
ccggtcctgaatgtgctcaccgacgggcagatccagcatctgctggttgcctacgaaccg
gtttgggccattggcagcggcaagagcgctgaagtgcgggatgccgtggctgctgcggac
ctgatccggaaagctgttgcggaaaaattcggcaaagaggcggcccggcgggtccggatc
ctctacggcggcagtgtgaccagcgaaaatgcccatgccttccatgaagacggcatcgat
ggcgtactggtaggcggggccagcctgtctgcccaggaattctgcgccattgccaacacg
ttctga

DBGET integrated database retrieval system