KEGG   Acidaminococcus fermentans: Acfer_0972Help
Entry
Acfer_0972        CDS       T01151                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
afn  Acidaminococcus fermentans
Brite
Enzymes [BR:afn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Acfer_0972
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1100102..1100836
Genome map
AA seq 244 aa AA seqDB search
MLQGAEPYFWPGTRGKGVLLVHGFTGSPSELRELGEILHRKGYTVEGLLLKGHGTDPRDL
LEAKAEQWEEQVRQGVAHLKETCAQVTVIGLSMGGLLALYAGAATSADKLVVISTPIYLY
DWRVYFLWLADRLPYWAIPKRPRTIDAPARYNVAYRCMPIKGVHQLVRLLQAVKRSWLPR
VRQPLLIIQSRTDHTVRPESASYIEEHAASARKQVLWVPQARHVMTLYKGRQAIYAAIEA
FLEE
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgctccagggagcggaaccgtatttctggcccgggacccggggaaaaggggtgctgctg
gtccatgggttcaccggcagtccgtcggaactgcgggaactgggagaaatcctgcaccgg
aaagggtatacggtggaaggccttctcctgaagggccacgggacggatccccgggacctg
ctggaggcaaaagcggaacagtgggaggaacaggtgcgccagggtgtggcccatctgaag
gaaacctgtgcccaggtgacggtgatcggtctttccatgggagggctcctggctttgtac
gccggggcggcaacgtccgcagacaaactggtggtgatttccacccccatctatctgtac
gactggcgggtgtacttcctgtggctggcggaccggctgccctactgggccattcccaag
cgtccccggaccatcgacgctccggcccggtacaatgtggcctaccggtgcatgcccatc
aaaggggtccatcagctggtgcggctgcttcaggcggtgaaacggtcctggctgccccgg
gtgcggcagcccctgctgatcatccagtccaggacggaccacacggtgcggccggaaagc
gcatcctatatcgaagaacatgcggcgtcggcccggaaacaggtgctgtgggtgccccag
gcccggcatgtgatgacattatacaaaggccggcaggccatttatgctgccattgaggcc
tttttggaggaatag

DBGET integrated database retrieval system