KEGG   Acidaminococcus fermentans: Acfer_1044Help
Entry
Acfer_1044        CDS       T01151                                 

Definition
(GenBank) ABC transporter related protein
  KO
K06147  
ATP-binding cassette, subfamily B, bacterial
Organism
afn  Acidaminococcus fermentans
Brite
Transporters [BR:afn02000]
 ABC Transporters, Eukaryotic Type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    Acfer_1044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1178370..1180112)
Genome map
AA seq 580 aa AA seqDB search
MGKEKNDSSWETLKKVWQIIDAYRLLLVGSLVLAGASVALQLYVPILFGRAIDGIAGPGK
VDFALVKGYTFQILVLVVLSSLATWAMNLINNKLAFNTVRDIRSRAIRQIQQLPLSFLDS
HSTGDLVQRVIADVDQISDGLLLGFTQLFSGLVTIVLTLYFMFSTHGKISLMVMVLTPVS
FLVARFIANRSYRLFQKQTAIRGKQTALINETVGNEKVVKAFRHEERSSRQFRGLNEDLQ
QATQGALFYSSLTNPSTRAVNNVIYALVALVGCWEILAGGLTVGGLTVLLYYANQYMKPF
TDISSVVTELQNALACAARVFALIEETPQSPDPDRQLTFQEGRLAIDHVYFSYNKKRPLI
EDFNFQVEPGQTTAIVGPTGCGKSTFINLLMRFYDVDRGTIAIDGQDTARVDRHSLRRTY
GMVLQETWLKQGTIRENIAFGKPEATEEEIIRAAKEAHSWEFIRRMPQGLDTVVSDDSLS
QGQKQLLCITRVMLALPPMLILDEATSSIDTRTEILIQNAFAKLMEGRTSFIVAHRLSTI
RNADRILVMKDGKIIEQGTHEKLMEQGGFYKDLYNSQFAG
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaggaaaagaacgattccagttgggaaactctgaaaaaagtctggcagatcatc
gacgcctaccggctgctcctcgtggggagcctggtcctggccggggcttccgtggccctg
cagctgtatgtgcccatcctgttcggccgggccatcgacggcattgcagggccgggcaag
gtggatttcgctctggtaaaagggtacaccttccagatcctggtgctggtggtcctgtcc
agtctggccacctgggccatgaacctgatcaacaacaaactggccttcaacaccgtccgg
gatatccggagccgggctatccggcagatccagcagctgcccctttccttcctggacagc
cacagcaccggggacctggtccagcgggtgatcgccgatgtggaccagatctctgacggg
ctgctcctgggctttacccagctgttctccggtctggtgaccattgtactgaccctgtac
ttcatgttttccacccacgggaagatttccctgatggtgatggtgctgaccccggtcagc
tttctggtggcccggttcatcgccaaccggtcctaccggctgttccagaaacagaccgcc
atccgggggaaacagaccgctctcatcaacgaaaccgtgggcaatgaaaaggtggtcaag
gccttccgccatgaagaacggtcctccagacagttccggggcctgaacgaagacctgcag
caggccacccagggagccctgttttacagttccctgaccaacccctccacccgggcagtg
aacaatgtgatctatgccctggtggccctggtggggtgctgggagatcctggcgggaggg
ctcaccgtcggggggctcaccgtgctgctctattacgccaaccagtacatgaagcccttt
acggatatcagctccgtggtcaccgaactccagaatgccctggcctgtgccgcccgggtg
ttcgccctcatcgaggaaacgcctcagagcccggatccggaccggcagctgaccttccag
gaaggccggctggccatcgaccatgtgtatttttcctacaataaaaagcggccgctgatc
gaagacttcaacttccaggtggagccgggccagaccaccgccattgtggggcccaccggc
tgcggcaagagtaccttcatcaacctgctcatgcggttctatgatgtggatcgggggacc
attgccatcgacggccaggatacggcccgggtggaccgccattctctccggcggacctac
ggcatggtgctccaggaaacctggctgaagcaggggaccatccgggaaaacatcgccttt
ggaaaaccggaggctacggaagaagaaatcatccgggccgccaaagaagcccacagctgg
gaattcatccgccggatgccccagggactggatacggtggtgagcgatgacagcctgagc
cagggacagaaacaactgctgtgcatcacccgggtgatgctggccctgccgcccatgctg
atcctggacgaagccacctccagcatcgatacccggaccgagatcctgatccagaacgcc
tttgccaagctgatggaaggacgcaccagcttcatcgtggctcaccggctcagcaccatc
cgcaatgcggaccggatcctggtaatgaaagacgggaagatcatcgaacagggaacccac
gaaaaactgatggaacagggcgggttttacaaagacctgtacaacagccagttcgcaggg
tga

DBGET integrated database retrieval system