KEGG   Acidaminococcus fermentans: Acfer_1375Help
Entry
Acfer_1375        CDS       T01151                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
afn  Acidaminococcus fermentans
Pathway
afn00900  Terpenoid backbone biosynthesis
afn01100  Metabolic pathways
afn01110  Biosynthesis of secondary metabolites
afn01130  Biosynthesis of antibiotics
Module
afn_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:afn00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Acfer_1375
Enzymes [BR:afn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Acfer_1375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C Semialdhyde_dh Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: ADB47735
JGI: Acfer_1375
UniProt: D2RKY3
Position
complement(1525797..1526951)
Genome map
AA seq 384 aa AA seqDB search
MKKIAILGSTGSIGTQTLDVAAANPERIRVVALAAHKNDALLEAQIRKFQPLVAALSDPA
AAKRLKERYNGPTEILSGPEGIMAAATCSEADTVLGAMVGYAGLRPTLAAIRAGKHIALA
NKETLVAAGSLVMDAVKKAGVRLTPVDSEHSAIFQCLQGNAHKDLKRILLTASGGPFRGR
TREELQGVTVEQCLHHPTWTMGTKVTIDSSTLANKGLEVIEAHWLFDAPYEKIVPIIHPQ
SIVHSLVEYSDGAVMAQLGVADMKLPIQYALSWPDRWPVAFDQLDLVKAGALEFYEPDTK
VFRALALAIQAGKTGGTLPCTFNAANEVAVASFLQGRLSFLGIADLIEKVLEATVPEKVD
GYETIVEADRKARALAEDLVARGQ
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaatcgcaatattggggtccaccggttccatcggcacccagaccctggatgtg
gcggcggccaacccggaacggatccgggtggtggctctggcggcccataaaaacgatgcc
ttgctggaagcccagatccggaagttccagcccctggtggcggccctttcggatcctgca
gcggccaaaaggctgaaggaacggtacaacggacctacggagatcctcagcggtcccgaa
gggatcatggccgcagccacctgcagcgaagcggatacggtgctgggtgccatggtgggc
tatgcggggcttcgtcccaccctggcggccatccgggccgggaagcacattgccctggcc
aacaaggagaccctggtggcggcgggcagcctggtgatggacgcggtgaaaaaggccggg
gtccgtctgacccctgtggacagcgaacacagtgccattttccagtgtctccagggcaac
gcccacaaagacctgaaacggatcctgctgacggcctccggggggcccttccggggcagg
acccgggaagaactccagggggtgaccgtggagcagtgcctccatcatcccacctggacc
atgggcaccaaggtgaccatcgattcctccaccctggccaacaaaggacttgaagtgatc
gaggcccactggctgtttgatgctccctatgaaaagatcgttcccatcatccatccccag
agcatcgtccacagcctggtggaatacagcgacggggcggtgatggcccagctgggggta
gcggatatgaagctgcccatccagtatgccctcagctggccggaccggtggccggtggcc
tttgaccagctggacctggtgaaggccggggccctggaattttatgaaccggataccaaa
gtcttccgtgccctggccctggccatccaggctgggaaaaccggcggcaccctgccctgc
accttcaatgcggccaacgaagtggcggtggcttcctttctccagggccggctgtccttc
ctgggcattgccgacctgatcgaaaaggtgctggaagccacggtgccggaaaaagtggac
gggtacgaaaccattgtggaagcggaccggaaggcccgggccctggcggaagacctggtg
gcccggggacagtag

DBGET integrated database retrieval system